spacer

EBI Dbfetch

ID   AF518338; SV 1; linear; genomic DNA; STD; ROD; 1140 BP.
XX
AC   AF518338;
XX
DT   28-NOV-2002 (Rel. 73, Created)
DT   15-APR-2005 (Rel. 83, Last updated, Version 2)
XX
DE   Mastomys erythroleucus specimen-voucher 4123 cytochrome b (cytb) gene,
DE   partial cds; mitochondrial gene for mitochondrial product.
XX
KW   .
XX
OS   Mastomys erythroleucus (Guinea multimammate mouse)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Glires; Rodentia; Sciurognathi; Muroidea;
OC   Muridae; Murinae; Mastomys.
OG   Mitochondrion
XX
RN   [1]
RP   1-1140
RX   DOI; 10.1016/S1631-0691(02)01488-9.
RX   PUBMED; 12360851.
RA   Lecompte E., Granjon L., Peterhans J.K., Denys C.;
RT   "Cytochrome b-based phylogeny of the Praomys group (Rodentia, Murinae): a
RT   new African radiation?";
RL   C. R. Biol. 325(7):827-840(2002).
XX
RN   [2]
RP   1-1140
RA   Lecompte E., Granjon L., Kerbis Perterhans J.C., Denys C.;
RT   ;
RL   Submitted (05-JUN-2002) to the INSDC.
RL   Laboratoire Zoologie Mammiferes et Oiseaux, Museum National d'Histoire
RL   Naturelle, 55, rue Buffon, Paris 75005, France
XX
DR   MD5; 05da200869b354bac76cc5ef28d54817.
DR   EuropePMC; PMC2490707; 18616808.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1140
FT                   /organism="Mastomys erythroleucus"
FT                   /organelle="mitochondrion"
FT                   /mol_type="genomic DNA"
FT                   /country="Chad: Tinga"
FT                   /specimen_voucher="4123"
FT                   /db_xref="taxon:41268"
FT   CDS             1..>1140
FT                   /codon_start=1
FT                   /transl_table=2
FT                   /gene="cytb"
FT                   /product="cytochrome b"
FT                   /db_xref="GOA:Q8HNJ1"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="UniProtKB/TrEMBL:Q8HNJ1"
FT                   /protein_id="AAN75655.1"
FT                   /translation="MTNIRKTHPLLKIINHSFIDLPAPSNISSWWNFGSLLGICLMIQI
FT                   ITGLFLAMHYTSDTMTAFSSVTHICRDVNYGWVIRYMHANGASMFFICLFLHVGRGMYY
FT                   GSYTFMETWNIGVVLLFAVMATAFMGYVLPWGQMSFWGATVITNLLSAIPYIGTTLVEW
FT                   IWGGFSVDKATLTRFFAFHFILPFIIAALVIVHLLFLHETGSNNPTGLNSDSDKIPFHP
FT                   YYTIKDILGAIMMITLLMMLVLFFPDLLGDPDNYTPANPLNTPPHIKPEWYFLFAYAIL
FT                   RSIPNKLGGVLALILSILILALMPLLHTSKQRSLTFRPITQTLYWILVANLLVLTWIGG
FT                   QPVEHPFIIIGQLASISYFSIILILMPISGIIEDNLLKWN"
XX
SQ   Sequence 1140 BP; 367 A; 300 C; 143 G; 330 T; 0 other;
     atgacaaaca tccgaaaaac tcacccacta ctcaaaatta tcaaccattc attcattgac        60
     ctacctgctc catccaatat ctcatcatga tgaaacttcg gctctctatt aggaatctgc       120
     ctaataatcc aaatcattac aggcttattc ctggcaatac actacacatc agatactata       180
     acagcattct catcagttac acatatctgc cgagacgtaa actacggatg agtaatccga       240
     tatatacacg caaatggagc atcaatattt tttatttgct tatttcttca tgtaggacga       300
     ggaatatatt atggatccta cacattcata gaaacatgaa atattggagt agttctactt       360
     ttcgcagtaa tagcaaccgc attcataggc tatgtacttc catgaggaca aatatctttc       420
     tggggagcaa cagtcattac aaacctacta tcagcaattc catacattgg aactacgcta       480
     gtggagtgaa tttgaggggg attctcagta gataaagcaa cactaacacg ctttttcgca       540
     ttccacttca tcctcccatt cattatcgca gctctagtta ttgtccacct tttgtttctt       600
     cacgaaacag gctctaataa tccaacaggc ttaaactctg actcagataa aattccattc       660
     cacccatact atacaattaa agacattctt ggagctatca taataattac tctcctaatg       720
     atactagtac tatttttccc agacttacta ggagaccctg acaactatac accagccaac       780
     ccactaaaca cccctcccca tattaagcca gaatgatatt tcctctttgc ctacgccatc       840
     ctacgatcta tccctaataa acttggagga gtcttagctc taatcctctc cattttaatc       900
     ctagcattaa tacccctact ccacacctca aaacaacgaa gtcttacatt ccgtccaatc       960
     acacaaaccc tttactgaat cctagtagct aacctactag tactaacttg aatcggaggc      1020
     caaccagtag aacacccatt tatcattatt ggccagctag catcaattag ctacttctct      1080
     attatcctca tccttatacc aatctcagga atcatcgaag acaacctact caaatgaaac      1140
//


spacer
spacer