spacer

EBI Dbfetch

ID   AF517128; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AF517128;
XX
DT   25-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*02var allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Tilanus M.G.J., Dijk A., Rozemuller E.H.;
RT   "A new DPB1*0201 variant identifed in a sample of the UCLA international
RT   DNA exchange";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Tilanus M.G.J., Dijk A., Rozemuller E.H.;
RT   ;
RL   Submitted (31-MAY-2002) to the INSDC.
RL   Pathology, H04.312, University Medical Center Utrecht, P.O.Box 85500,
RL   Utrecht 3508GA, the Netherlands
XX
DR   MD5; 0c1b613dc79bcbf2d38df0d2008d62c9.
DR   Ensembl-Gn; ENSG00000229295; homo_sapiens.
DR   Ensembl-Tr; ENST00000415996; homo_sapiens.
DR   Ensembl-Tr; ENST00000445925; homo_sapiens.
DR   Ensembl-Tr; ENST00000447783; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>264
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8MH49"
FT                   /db_xref="IMGT/HLA:DPB1*02:01:06"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MH49"
FT                   /protein_id="AAM62425.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            1..264
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 264 BP; 61 A; 63 C; 98 G; 42 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagt ttgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg atgaggagta ctggaacagc cagaaggaca       180
     tcctggagga ggagcgggca gtgccggaca ggatgtgcag acacaactac gagctgggcg       240
     ggcccatgac cctgcagcgc cgag                                              264
//


spacer
spacer