spacer

EBI Dbfetch

ID   AF510721; SV 1; linear; genomic DNA; STD; HUM; 871 BP.
XX
AC   AF510721;
XX
DT   03-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*0801 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-871
RX   DOI; 10.1111/j.1399-0039.2005.00414.x.
RX   PUBMED; 15982262.
RA   Chu C.C., Lee H.L., Chen Z.X., Lin M.;
RT   "A newly identified HLA-C allele: Cw*1210, and confirmation of
RT   HLA-Cw*080102";
RL   Tissue Antigens 66(1):61-63(2005).
XX
RN   [2]
RP   1-871
RA   Chu C.-C.;
RT   "A new HLA-Cw allele found in one of Taiwan indigenous tribes with a
RT   frequency of 5%";
RL   Unpublished.
XX
RN   [3]
RP   1-871
RA   Chu C.-C.;
RT   ;
RL   Submitted (09-MAY-2002) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, 92 Sec. 2 Chung-San
RL   North Road, Taipei, Taiwan
XX
DR   MD5; 88aa25a425ec5a9148e1c97a8878f14e.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..871
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>871
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801 variant"
FT   mRNA            join(<69..338,585..>860)
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,585..>860)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8MH57"
FT                   /db_xref="IMGT/HLA:C*08:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8MH57"
FT                   /protein_id="AAM44831.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVQFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARTAEQLRAYLEGTC
FT                   VEWLRRYLENGKKTLQRA"
FT   exon            69..338
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801 variant"
FT                   /number=2
FT   exon            585..860
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*0801 variant"
FT                   /number=3
XX
SQ   Sequence 871 BP; 153 A; 292 C; 316 G; 110 T; 0 other;
     gggcgcagga cccggggagc cgcgcaggga ggagggtcgg gcgggtctca gcccctcctc        60
     gcccccaggc tcccactcca tgaggtattt ctacaccgcc gtgtcccggc ccggccgcgg       120
     agagccccgc ttcatcgcag tgggctacgt ggacgacacg cagttcgtgc agttcgacag       180
     cgacgccgcg agtccaagag gggagccgcg ggcgccgtgg gtggagcagg aggggccgga       240
     gtattgggac cgggagacac agaagtacaa gcgccaggca cagactgacc gagtgagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcccggggc       360
     gcaggtcccg acccctcccc atcccccacg gacggcccgg gtcgccccga gtctcccggt       420
     ctgagatcca ccccgaggct gcggaacccg cccagaccct cgaccggaga gagccccagt       480
     cacctttacc cggtttcatt ttcagtttag gccaaaatcc ccgcgggttg gtcggggctg       540
     gggcggggct cgggggacgg ggctgaccac gggggcgggg ccagggtctc acaccctcca       600
     gaggatgtac ggctgcgacc tggggcccga cgggcgcctc ctccgcgggt ataaccagtt       660
     cgcctacgac ggcaaggatt acatcgccct gaatgaggac ctgcgctcct ggaccgccgc       720
     ggacacggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtacgg cggagcagct       780
     gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa       840
     gaagacgctg cagcgcgcgg gtaccagggg c                                      871
//


spacer
spacer