spacer

EBI Dbfetch

ID   AF509727; SV 1; linear; genomic DNA; STD; HUM; 51 BP.
XX
AC   AF509727;
XX
DT   03-MAY-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*0718 allele, exon 8
DE   and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-51
RX   DOI; 10.1034/j.1399-0039.2003.00110.x.
RX   PUBMED; 14617049.
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-C sequence based typing: nucleotide analysis from exon 1 through exon
RT   8. Identification of a new allele: Cw*0718";
RL   Tissue Antigens 62(5):418-425(2003).
XX
RN   [2]
RP   1-51
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   Immunogenetics, National Cancer Research Institute, Largo R. Benzi,10,
RL   Genova, GE 16132, Italy
XX
DR   MD5; 3dc75886641573d96485aef798c085bc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..51
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            order(AF509720.1:<1..73,AF509721.1:1..270,
FT                   AF509722.1:1..276,AF509723.1:1..276,AF509724.1:1..120,
FT                   AF509725.1:1..51,AF509726.1:1..51,1..>51)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT   mRNA            join(AF509720.1:<1..73,AF509721.1:1..270,AF509722.1:1..276,
FT                   AF509723.1:1..276,AF509724.1:1..120,AF509725.1:19..51,
FT                   AF509726.1:4..51,47..>51)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /product="MHC class I antigen"
FT   CDS             join(AF509720.1:1..73,AF509721.1:1..270,AF509722.1:1..276,
FT                   AF509723.1:1..276,AF509724.1:1..120,AF509725.1:19..51,
FT                   AF509726.1:4..51,47..51)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q85ZX8"
FT                   /db_xref="IMGT/HLA:C*07:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q85ZX8"
FT                   /protein_id="AAP30863.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQVACSNSAQGSDESLITCKA"
FT   exon            47..>51
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=8
XX
SQ   Sequence 51 BP; 11 A; 10 C; 10 G; 20 T; 0 other;
     ttaccatgac tgacctgaat ttgttcatga ctattgtgtt ctgtagcctg a                 51
//


spacer
spacer