Dbfetch

ID   AH012811; SV 2; linear; genomic DNA; STD; HUM; 1868 BP.
XX
AC   AH012811; AF509720-AF509727;
XX
DT   13-JUN-2016 (Rel. 129, Created)
DT   13-JUN-2016 (Rel. 129, Last updated, Version 1)
XX
DE   Homo sapiens chromosome 6 MHC class I antigen (HLA-Cw) gene, HLA-Cw*0718
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-73,174-443,544-819,920-1195,1296-1415,1667-1717,1818-1868
RX   DOI; 10.1034/j.1399-0039.2003.00110.x.
RX   PUBMED; 14617049.
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-C sequence based typing: nucleotide analysis from exon 1 through exon
RT   8. Identification of a new allele: Cw*0718";
RL   Tissue Antigens 62(5):418-425(2003).
XX
RN   [2]
RP   1516-1566
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   "HLA-Cw*07 novel allele";
RL   Unpublished.
XX
RN   [3]
RP   1-1868
RA   Delfino L., Morabito A., Ferrara G.B.;
RT   ;
RL   Submitted (07-MAY-2002) to the INSDC.
RL   Immunogenetics, National Cancer Research Institute, Largo R. Benzi,10,
RL   Genova, GE 16132, Italy
XX
DR   MD5; 3bdb32341123d22f1585b074ed7ba09e.
XX
CC   On or before Jun 10, 2016 this sequence version replaced
CC   gi:30315343, gi:30315344, gi:30315345, gi:30315346, gi:30315347,
CC   gi:30315348, gi:30315349, gi:30315350, gi:30315342.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1868
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1868
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT   mRNA            join(<1..73,174..443,544..819,920..1195,1296..1415,
FT                   1534..1566,1670..1717,1864..>1868)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,544..819,920..1195,1296..1415,
FT                   1534..1566,1670..1717,1864..1868)
FT                   /codon_start=1
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q85ZX8"
FT                   /protein_id="AAP30863.1"
FT                   /translation="MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRN
FT                   LRGYYNQSEDGSHTLQRMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGG
FT                   KGGSCSQVACSNSAQGSDESLITCKA"
FT   exon            <1..73
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=1
FT   gap             74..173
FT                   /estimated_length=unknown
FT   exon            174..443
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=2
FT   gap             444..543
FT                   /estimated_length=unknown
FT   exon            544..819
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=3
FT   gap             820..919
FT                   /estimated_length=unknown
FT   exon            920..1195
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=4
FT   gap             1196..1295
FT                   /estimated_length=unknown
FT   exon            1296..1415
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=5
FT   gap             1416..1515
FT                   /estimated_length=unknown
FT   exon            1534..1566
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=6
FT   gap             1567..1666
FT                   /estimated_length=unknown
FT   exon            1670..1717
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=7
FT   gap             1718..1817
FT                   /estimated_length=unknown
FT   exon            1864..>1868
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*0718"
FT                   /number=8
XX
SQ   Sequence 1868 BP; 229 A; 361 C; 381 G; 197 T; 700 other;
     atgcgggtca tggcgccccg agccctcctc ctgctgctct cgggaggcct ggccctgacc        60
     gagacctggg cctnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttcgaca ccgccgtgtc ccggcccggc cgcggagagc cccgcttcat       240
     ctcagtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagtcc       300
     gagaggggag ccgcgggcgc cgtgggtgga gcaggagggg ccggagtatt gggaccggga       360
     gacacagaac tacaagcgcc aggcacaggc tgaccgagtg agcctgcgga acctgcgcgg       420
     ctactacaac cagagcgagg acgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnggtctca caccctccag aggatgtatg gctgcgacct ggggcccgac gggcgcctcc       600
     tccgcgggta tgaccagtcc gcctacgacg gcaaggatta catcgccctg aacgaggacc       660
     tgcgctcctg gaccgccgcg gacaccgcgg ctcagatcac ccagcgcaag ttggaggcgg       720
     cccgtgcggc ggagcagctg agagcctacc tggagggcac gtgcgtggag tggctccgca       780
     gatacctgga gaacgggaag gagacgctgc agcgcgcagn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn nnnnnnnnna acccccaaag acacacgtga cccaccaccc cctctctgac       960
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc      1020
     tggcagcggg atggggagga ccagacccag gacaccgagc ttgtggagac caggccagca      1080
     ggagatggaa ccttccagaa gtgggcagct gtggtggtgc cttctggaca agagcagaga      1140
     tacacgtgcc atatgcagca cgaggggctg caagagcccc tcaccctgag ctgggnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnagcca tcttcccagc ccaccatccc      1320
     catcatgggc atcgttgctg gcctggctgt cctggttgtc ctagctgtcc ttggagctgt      1380
     ggtcaccgct atgatgtgta ggaggaagag ctcagnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnggcat tttcttccca caggtggaaa aggagggagc tgctctcagg      1560
     ttgcgtnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnncagg cagcaacagt      1680
     gcccagggct ctgatgagtc tctcatcact tgtaaagnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1800
     nnnnnnnnnn nnnnnnntta ccatgactga cctgaatttg ttcatgacta ttgtgttctg      1860
     tagcctga                                                               1868
//