spacer

EBI Dbfetch

ID   AF497643; SV 1; linear; genomic DNA; STD; HUM; 264 BP.
XX
AC   AF497643;
XX
DT   25-APR-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*04 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-264
RA   Humphreys I., Fleet A.P.;
RT   "Novel DRB1*04 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-264
RA   Humphreys I., Fleet A.P.;
RT   ;
RL   Submitted (02-APR-2002) to the INSDC.
RL   Transplant Services, ARCBS, 301 Pirie Street, Adelaide, SA 5000, Australia
XX
DR   MD5; f5ce921519835f1e575d364a717e2b43.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>264
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>264
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8SNC0"
FT                   /db_xref="IMGT/HLA:DRB1*04:44"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC0"
FT                   /protein_id="AAM18713.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDNYCRHNYGVVESFTVQ"
XX
SQ   Sequence 264 BP; 59 A; 62 C; 94 G; 49 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaatta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagc                                              264
//


spacer
spacer