spacer

EBI Dbfetch

ID   AF497262; SV 1; linear; genomic DNA; STD; HUM; 1965 BP.
XX
AC   AF497262;
XX
DT   22-APR-2002 (Rel. 71, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1965
RA   Smith D.M., Martens G., Baxter-Lowe L.A., Duquesnoy R., Murrari M.,
RA   Scornik J., Williams T., Pollack M.;
RT   "Characterization of a Novel Allele, B*35xx, and Typing of Rare Class I HLA
RT   Alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1965
RA   Smith D.M., Martens G., Baxter-Lowe L.A., Duquesnoy R., Murrari M.,
RA   Scornik J., Williams T., Pollack M.;
RT   ;
RL   Submitted (28-MAR-2002) to the INSDC.
RL   Pathology, Baylor University Medical Center, 3500 Gaston Ave., Dallas, TX
RL   75214, USA
XX
DR   MD5; b14373a35682928df973eb9fdda9362a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1965
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1965
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT   mRNA            join(<1..32,162..431,677..952,1528..1803,1908..>1965)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..32,162..431,677..952,1528..1803,1908..>1965)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8SNC1"
FT                   /db_xref="IMGT/HLA:B*35:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC1"
FT                   /protein_id="AAM16153.1"
FT                   /translation="GAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVR
FT                   FDSDAASPRTEPRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHI
FT                   IQRMYGCDLGPDGRLLRGHDQSACDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVA
FT                   EQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAE
FT                   ITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT
FT                   LRWEPSSQSTIPIVGIVAGLAVL"
FT   exon            <1..32
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=1
FT   exon            162..431
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=2
FT   exon            677..952
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=3
FT   exon            1528..1803
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=4
FT   exon            1908..>1965
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35"
FT                   /number=5
XX
SQ   Sequence 1965 BP; 369 A; 610 C; 639 G; 347 T; 0 other;
     gggggcagtg gccctgaccg agacctgggc cggtgagtgc ggggtcggga gggaaatggc        60
     ctctgtgggg aggagcgagg ggaccgcagg cgggggcgca ggacctgagg agccgcgccg       120
     ggaggagggt cgggcgggtc tcagcccctc ctcgccccca ggctcccact ccatgaggta       180
     tttctacacc gccatgtccc ggcccggccg cggggagccc cgcttcatcg cagtgggcta       240
     cgtggacgac acccagttcg tgaggttcga cagcgacgcc gcgagtccga ggacggagcc       300
     ccgggcgcca tggatagagc aggaggggcc ggagtattgg gaccggaaca cacagatctt       360
     caagaccaac acacagactt accgagagag cctgcggaac ctgcgcggct actacaacca       420
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       480
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cctccctgag gccgcgggac       540
     ccgcccagac cctcgaccgg cgagagcccc aggcgcgttt acccggtttc attttcagtt       600
     gaggccaaaa tccccgcggg ttggtcgggg cggggcgggg ctcgggggac ggggctgacc       660
     gcggggccgg ggccagggtc tcacatcatc cagaggatgt atggctgcga cctggggccc       720
     gacgggcgcc tcctccgcgg gcatgaccag tccgcctgcg acggcaagga ttacatcgcc       780
     ctgaacgagg acctgagctc ctggaccgcg gcggacaccg cggctcagat cacccagcgc       840
     aagtgggagg cggcccgtgt ggcggagcag ctgagagcct acctggaggg cctgtgcgtg       900
     gagtggctcc gcagatacct ggagaacggg aaggagacgc tgcagcgcgc gggtaccagg       960
     ggcagtgggg agccttcccc atctcctata ggtcgccggg gatggcctcc cacgagaaga      1020
     ggaggaaaat gggatcagcg ctagaatgtc gccctccctt gaatggagaa tggcatgagt      1080
     tttcctgagt ttcctctgag ggccccctct tctctctagg acaattaagg gatgacgtct      1140
     ctgaggaaat ggaggggaag acagtcccta gaatactgat caggggtccc ctttgacccc      1200
     tgcagcagcc ttgggaaccg tgacttttcc tctcaggcct tgttctctgc ctcacactca      1260
     gtgtgtttgg ggctctgatt ccagcacttc tgagtcactt tacctccact cagatcagga      1320
     gcagaagtcc ctgttccccg ctcagagact cgaactttcc aatgaatagg agattatccc      1380
     aggtgcctgc gtccaggctg gtgtctgggt tctgtgcccc ttccccacac caggtgtcct      1440
     gtccattctc aggctggtca catgggtggt cctagggtgt cccatgagag atgcaaagcg      1500
     cctgaatttt ctgactcttc ccatcagacc ccccaaagac acacgtgacc caccaccccg      1560
     tctctgacca tgaggccacc ctgaggtgct gggccctggg cttctaccct gcggagatca      1620
     cactgacctg gcagcgggat ggcgaggacc aaactcagga cactgagctt gtggagacca      1680
     gaccagcagg agatagaacc ttccagaagt gggcagctgt ggtggtgcct tctggagaag      1740
     agcagagata cacatgccat gtacagcatg aggggctgcc gaagcccctc accctgagat      1800
     ggggtaagga gggggatgag gggtcatatc tcttctcagg gaaagcagga gcccttctgg      1860
     agcccttcag cagggtcagg gcccctcgtc ttcccctcct ttcccagagc catcttccca      1920
     gtccaccatc cccatcgtgg gcattgttgc tggcctggct gtcct                      1965
//


spacer
spacer