spacer

EBI Dbfetch

ID   AF492642; SV 1; linear; genomic DNA; STD; HUM; 285 BP.
XX
AC   AF492642;
XX
DT   01-APR-2003 (Rel. 75, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, HLA-DPB1*0202 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-285
RA   Luo M., Mao X., Shehzad I., Jacobson K., Kwan L., Shroeder M.,
RA   Plummer F.A.;
RT   "Sequence-Based DPB Typing Fills the Missing Exon 2 Sequences of Multiple
RT   HLA-DPB1 Alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-285
RA   Luo M., Mao X., Shehzad I., Jacobson K., Kwan L., Shroeder M.,
RA   Plummer F.A.;
RT   ;
RL   Submitted (14-MAR-2002) to the INSDC.
RL   Medical Microbiology, University of Manitoba, R507 BMSB, 730 William
RL   Avenue, Winnipeg, Manitoba R3E 0W3, Canada
XX
DR   MD5; a4d60eed3b9b194bb04166c747fefe69.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..285
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <20..>283
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <20..>283
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q860Z5"
FT                   /db_xref="IMGT/HLA:DPB1*02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q860Z5"
FT                   /protein_id="AAO84767.1"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
FT   exon            20..283
FT                   /gene="HLA-DPB1"
FT                   /number=2
XX
SQ   Sequence 285 BP; 61 A; 78 C; 104 G; 42 T; 0 other;
     gtccgccccc tccccgcaga gaattacctt ttccagggac ggcaggaatg ctacgcgttt        60
     aatgggacac agcgcttcct ggagagatac atctacaacc gggaggagct cgtgcgcttc       120
     gacagcgacg tgggggagtt ccgggcggtg acggagctgg ggcggcctga ggcggagtac       180
     tggaacagcc agaaggacat cctggaggag gagcgggcag tgccggacag gatgtgcaga       240
     cacaactacg agctgggcgg gcccatgacc ctgcagcgcc gaggt                       285
//


spacer
spacer