spacer

EBI Dbfetch

ID   AF489518; SV 1; linear; genomic DNA; STD; HUM; 373 BP.
XX
AC   AF489518;
XX
DT   22-MAR-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate VTIS71787 MHC class II antigen (HLA-DPB1) gene, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-373
RA   Varney M.D., Jennings K.;
RT   "A Novel DPB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-373
RA   Varney M.D., Jennings K.;
RT   ;
RL   Submitted (28-FEB-2002) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, c/o Royal Melbourne
RL   Hospital, Grattan Street, Parkville, Vic 3050, Australia
XX
DR   MD5; c4ccb6b4505e3e6a3d0962e3febfebe6.
DR   Ensembl-Gn; ENSG00000215048; homo_sapiens.
DR   Ensembl-Gn; ENSG00000223865; homo_sapiens.
DR   Ensembl-Gn; ENSG00000226826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230763; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236693; homo_sapiens.
DR   Ensembl-Gn; ENSG00000237710; homo_sapiens.
DR   Ensembl-Tr; ENST00000399500; homo_sapiens.
DR   Ensembl-Tr; ENST00000411749; homo_sapiens.
DR   Ensembl-Tr; ENST00000418931; homo_sapiens.
DR   Ensembl-Tr; ENST00000425130; homo_sapiens.
DR   Ensembl-Tr; ENST00000433800; homo_sapiens.
DR   Ensembl-Tr; ENST00000454006; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..373
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="VTIS71787"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <4..>267
FT                   /gene="HLA-DPB1"
FT   exon            4..267
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   CDS             <4..>267
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P04440"
FT                   /db_xref="HGNC:HGNC:4940"
FT                   /db_xref="IMGT/HLA:DPB1*92:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="UniProtKB/Swiss-Prot:P04440"
FT                   /protein_id="AAL92172.1"
FT                   /translation="NYVYQLRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTE
FT                   LGRPDEDYWNSQKDLLEEKRAVPDRVCRHNYELDEAVTLQRR"
XX
SQ   Sequence 373 BP; 79 A; 97 C; 144 G; 53 T; 0 other;
     cagagaatta cgtgtaccag ttacggcagg aatgctacgc gtttaatggg acacagcgct        60
     tcctggagag atacatctac aaccgggagg agttcgcgcg cttcgacagc gacgtggggg       120
     agttccgggc ggtgacggag ctggggcggc ctgatgagga ctactggaac agccagaagg       180
     acctcctgga ggagaagcgg gcagtgccgg acagggtatg cagacacaac tacgagctgg       240
     acgaggccgt gaccctgcag cgccgaggtg agtgagggct ttgggccggc ggtcccaggg       300
     cagccccgcg ggcccgtgcc cagggcgcag gagcagccgg gttggcctaa gggaccttag       360
     tgccgggcgg aaa                                                          373
//


spacer
spacer