Dbfetch

ID   AF487379; SV 1; linear; genomic DNA; STD; HUM; 3311 BP.
XX
AC   AF487379;
XX
DT   25-MAR-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*6702 allele, exons 1
DE   through 7 and complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3311
RA   Iglehart B.A., Leffell M.S.;
RT   "HLA-B*6702 (Promoter-3'UTR)";
RL   Unpublished.
XX
RN   [2]
RP   1-3311
RA   Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (25-FEB-2002) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 299696a79f3d33144353005d34966108.
DR   EPD; EP73522; HS_HLA-B.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3311
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   regulatory      90..102
FT                   /gene="HLA-B"
FT                   /note="enhancer A"
FT                   /regulatory_class="enhancer"
FT   misc_feature    111..124
FT                   /gene="HLA-B"
FT                   /note="interferon response sequence"
FT   regulatory      187..197
FT                   /gene="HLA-B"
FT                   /note="enhancer B"
FT                   /regulatory_class="enhancer"
FT   regulatory      212..216
FT                   /gene="HLA-B"
FT                   /regulatory_class="CAAT_signal"
FT   regulatory      239..243
FT                   /gene="HLA-B"
FT                   /regulatory_class="TATA_box"
FT   exon            <289..361
FT                   /gene="HLA-B"
FT                   /number=1
FT   mRNA            join(<289..361,490..759,1006..1281,1854..2129,2223..2339,
FT                   2781..2813,2920..>2963)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(289..361,490..759,1006..1281,1854..2129,2223..2339,
FT                   2781..2813,2920..2963)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q29836"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*67:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q29836"
FT                   /protein_id="AAL93257.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
FT   exon            490..759
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            1006..1281
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1854..2129
FT                   /gene="HLA-B"
FT                   /number=4
FT   exon            2223..2339
FT                   /gene="HLA-B"
FT                   /number=5
FT   exon            2781..2813
FT                   /gene="HLA-B"
FT                   /number=6
FT   exon            2920..>2963
FT                   /gene="HLA-B"
FT                   /number=7
XX
SQ   Sequence 3311 BP; 616 A; 959 C; 1047 G; 689 T; 0 other;
     gagggatcag gacgaagtcc caggtcccgg acggggctct cagggtctca ggctccgagg        60
     gccgcgtctg caatggggag gcgcagcgtt ggggattccc cactcccctg agtttcactt       120
     cttctcccaa cttgtgtcgg gtccttcttc caggatactc gtgacgcatc cccacttccc       180
     actcccattg ggtgtcggat atctagagaa gccaatcagc gtcgccgggg tcccagttct       240
     aaagtcccca cgcacccacc cggactcaga gtctcctcag acgccgagat gctggtcatg       300
     gcgccccgaa ccgtcctcct gctgctctcg gcggccctgg ccctgaccga gacctgggcc       360
     ggtgagtgcg ggtcgggagg gaaatggcct ctgccgggag gagcgagggg accgcaggcg       420
     ggggcgcagg acctgaggag ccgcgccggg aggagggtcg ggcgggtctc agcccctcct       480
     cgcccccagg ctcccactcc atgaggtatt tctacacctc cgtgtcccgg cccggccgcg       540
     gggagccccg cttcatctca gtgggctacg tggacgacac gcagttcgtg aggttcgaca       600
     gcgacgccgc gagtccaaga ggggagccgc gggcgccgtg ggtggagcag gaggggccgg       660
     agtattggga ccgggagaca cagaagtaca agcgccaggc acaggctgac cgagtgagcc       720
     tgcggaacct gcgcggctac tacaaccaga gcgaggccgg tgagtgaccc cggcccgggg       780
     cgcaggtcac gactccccat cccccacgta cggcccgggt cgccccgagt ctccgggtcc       840
     gagatccgcc tccctgaggc cgcgggaccc gcccagaccc tcgaccggcg agagccccag       900
     gcgcgtttac ccggtttcat tttcagttga ggccaaaatc cccgcgggtt ggtcggggcg       960
     gggcggggct cggggggacg gggctgaccg cggggccggg gccagggtct cacaccctcc      1020
     agaggatgta cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt      1080
     tcgcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg      1140
     cggacaccgc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc      1200
     tgagaaccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga      1260
     aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcctatag      1320
     gtcgccgggg atggcctcca acgagaagaa gaggaaaatg ggatcagcgc tagaatgtcg      1380
     ccctcccttg aatggagaat ggcatgagtt ttcctgagtt tcctctgagg gccccctctt      1440
     ctctctagga caattaaggg atgacgtctc tgaggaaatg gaggggaaga cagtccctag      1500
     aatactgatc aggggtcccc tttgacccct gcagcagcct tgggaaccat gacttttcct      1560
     ctcaggcctt gttctctgcc tcacactcag tgtgtttggg gctctgattc cagcacttct      1620
     gagtcacttt acctccactc agatcaggag cagaagtctc tgttccccgc tcagagactc      1680
     gaactttcca atgaatagat tatcccaggt gcctgcgtcc aggctggtgt ctgggttctg      1740
     tgccccttcc ccaccccagg tgtcctgtcc attctcaggc tggtcacatg ggtggtccta      1800
     gggtgtccca tgagagatgc aaagcgcctg aattttctga ctcttcccat cagacccccc      1860
     aaagacacat gtgacccacc accccatctc tgaccatgag gccaccctga ggtgctgggc      1920
     cctgggcttc taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac      1980
     tcaggacacc gagcttgtgg agaccagacc agcaggagac agaaccttcc agaagtgggc      2040
     agctgtggtg gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg      2100
     gctgccgaag cccctcaccc tgagatgggg taaggagggg gatgaggggt catatctctt      2160
     ctcagggaaa gcaggagccc ttcagcaggg tcagggcccc tcatcttccc ctcctttccc      2220
     agagccatct tcccagtcca ccgtccccat cgtgggcatt gttgctggcc tggctgtcct      2280
     agcagttgtg gtcatcggag ctgtggtcgc tgctgtgatg tgtaggagga agagttcagg      2340
     tagggaaggg gtgaggggtg gggtctgggt tttcttgtcc cactgggggt ttcaagcccc      2400
     aggtagaagt gttccctgca tcattactgg gaagcagcat gcacacaggg gctaacgcag      2460
     cctgggaccc tgtgtgccag cacttactct tttgtgcagc acatgtgaca atgaaggacg      2520
     gatgtatcac cttgatggtt gtggtgttgg ggtcctgatt ccagcattca tgagtcaggg      2580
     gaaggtccct gctaaggaca gaccttagga gggcagttgg tccaggaccc acacttgctt      2640
     tcctcgtgtt tcctgatcct gccctgggtc tgtagtcata cttctggaaa ttccttttgg      2700
     gtccaagact aggaggttcc tctaagatct catggccctg cttcctccca gtcccctcac      2760
     aggacatttt cttcccacag gtggaaaagg agggagctac tctcaggctg cgtgtaagtg      2820
     gtgggggtgg gagtgtgaag gagctcaccc accccataat tcctcctgtc ccacgtctcc      2880
     tgtgggctct gaccaggtcc tgtttttgtt ctactccagc cagcgacagt gcccagggct      2940
     ctgatgtgtc tctcacagct tgaaaaggtg agattcttgg ggtctagagt gggcgggggg      3000
     gcggggaggg ggcagagggg aaaggcctgg gtaatggaga ttctttgatt gggatgtttc      3060
     gcgtgtgtga tgggctgttc agagtgtcat cacttaccat gactaaccag aatttgttca      3120
     tgactgttgt tttctgtagc ctgagacagc tgtcttgtga gggactgaga tgcaggattt      3180
     cttcacgcct cccctttgtg acttcaagag cctctggcat ctctttctgc aaaggcacct      3240
     gaatgtgtct gcgtccctgt tagcataatg tgaggaggtg gagagacagc ccacccttgt      3300
     gtccactgtg a                                                           3311
//