spacer

EBI Dbfetch

ID   AF480841; SV 1; linear; genomic DNA; STD; HUM; 1742 BP.
XX
AC   AF480841;
XX
DT   08-MAR-2002 (Rel. 71, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*30-related new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1742
RX   DOI; 10.1111/j.1399-0039.2005.00421.x.
RX   PUBMED; 15982258.
RA   Alonso-Nieto M., Garcia-Sanchez F., Lillo R., Balas A., Blanco L.,
RA   Aviles-Egea M.J., Zarapuz L., Vicario J.L.;
RT   "Four new HLA class I alleles in Cauacasoids";
RL   Tissue Antigens 66(1):51-53(2005).
XX
RN   [2]
RP   1-1742
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   "Four new HLA class I alleles in Caucasoids";
RL   Unpublished.
XX
RN   [3]
RP   1-1742
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   ;
RL   Submitted (05-FEB-2002) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Menendez-Pelayo 65, Madrid
RL   28009, Spain
XX
DR   MD5; 67aa9d4aca035ce0e070aff3996e1e48.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1742
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1742
FT                   /gene="HLA-A"
FT                   /note="new allele related to HLA-A*30"
FT   mRNA            join(<74..343,585..860,1440..>1715)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<74..343,585..860,1440..>1715)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8SNC6"
FT                   /db_xref="IMGT/HLA:A*30:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC6"
FT                   /protein_id="AAL84893.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAHSQTDRENLGTLRGYYNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARRAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            74..343
FT                   /gene="HLA-A"
FT                   /number=2
FT   exon            585..860
FT                   /gene="HLA-A"
FT                   /number=3
FT   exon            1440..1715
FT                   /gene="HLA-A"
FT                   /number=4
XX
SQ   Sequence 1742 BP; 332 A; 528 C; 569 G; 313 T; 0 other;
     ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcggtcagg tctcagccac        60
     tgctcgcccc caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc       120
     cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt cgtgcggttc       180
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagagg       240
     cctgagtatt gggaccagga gacacggaat gtgaaggccc actcacagac tgaccgagag       300
     aacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg accccgcccg       360
     ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca cagtctccgg       420
     gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgacccggga gaggcccagg       480
     cgcctttacc cggtttcatt ttcagtttag gccaaaaatt cccccgggtt ggtcggggct       540
     gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccatcca       600
     gataatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt atgaacagca       660
     cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt ggaccgcggc       720
     ggacatggcg gctcagatca cccagcgcaa gtgggaggcg gcccgtcggg cggagcagtt       780
     gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg agaacgggaa       840
     ggagacgctg cagcgcacgg gtaccagggg ccacggggcg ccttcctgat cgcctgtaga       900
     tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact agaatatcac       960
     cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg taccagagag      1020
     tgactctgag gttccgccct gctctctgac tcaattaagg gataaaatct ctgaaggagt      1080
     gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg gcagcagcct      1140
     tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat gtgtgtgggg      1200
     gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc agaagtcgct      1260
     gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct ggtgtctggg      1320
     ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc cacatgcgtg      1380
     ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct tcccgtcaga      1440
     cccccccaag acacatatga cccaccaccc catctctgac catgaggcca ccctgaggtg      1500
     ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg atggggagga      1560
     ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa ccttccagaa      1620
     gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc atgtgcagca      1680
     tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg ggggtgtcat      1740
     gt                                                                     1742
//


spacer
spacer