spacer

EBI Dbfetch

ID   AF480614; SV 1; linear; genomic DNA; STD; HUM; 804 BP.
XX
AC   AF480614;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*07-related new
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-804
RX   DOI; 10.1111/j.1399-0039.2005.00421.x.
RX   PUBMED; 15982258.
RA   Alonso-Nieto M., Garcia-Sanchez F., Lillo R., Balas A., Blanco L.,
RA   Aviles-Egea M.J., Zarapuz L., Vicario J.L.;
RT   "Four new HLA class I alleles in Cauacasoids";
RL   Tissue Antigens 66(1):51-53(2005).
XX
RN   [2]
RP   1-804
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   "Four new HLA class I alleles in Caucasoids";
RL   Unpublished.
XX
RN   [3]
RP   1-804
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   ;
RL   Submitted (06-FEB-2002) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Menendez-Pelayo 65, Madrid
RL   28009, Spain
XX
DR   MD5; 92deae9f5c2c664c8e2d6fe5abfe8480.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..804
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>804
FT                   /gene="HLA-C"
FT                   /note="new allele related to HLA-Cw*07"
FT   mRNA            join(<3..272,518..>793)
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT   CDS             join(<3..272,518..>793)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen locus C"
FT                   /db_xref="GOA:Q8SNC7"
FT                   /db_xref="IMGT/HLA:C*07:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC7"
FT                   /protein_id="AAL87225.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEAGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            3..272
FT                   /gene="HLA-C"
FT                   /number=2
FT   exon            518..793
FT                   /gene="HLA-C"
FT                   /number=3
XX
SQ   Sequence 804 BP; 139 A; 268 C; 292 G; 105 T; 0 other;
     aggctcccac tccatgaggt atttcgacac cgccgtgtcc cggcccggcc gcggagagcc        60
     ccgcttcatc tcagtgggct acgtggacga cacgcagttc gtgcggttcg acagcgacgc       120
     cgcgagtccg agaggggagc cgcgggcgcc gtgggtggag caggaggggc cggagtattg       180
     ggaccgggag acacagaact acaagcgcca ggcacaggct gaccgagtga gcctgcggaa       240
     cctgcgcggc tactacaacc agagcgaggc cggtgagtga ccccggcccg gggcgcaggt       300
     cacgacccct ccccatcccc cacggacggc ccgggtcgcc ccgagtctcc gggtctgaga       360
     tccaccccga ggctgcggaa cccgcccaga ccctcgaccg gagagagccc cagtcgcctt       420
     tacccggttt cattttcggt ttaggccaaa atccccgcgg gttggtcggg gcggggcggg       480
     gctcggggga ctgggctgac cgcgggggcg gggccagggt ctcacaccct ccagaggatg       540
     tatggctgcg acctggggcc cgacgggcgc ctcctccgcg ggtatgacca gtccgcctac       600
     gacggcaagg attacatcgc cctgaacgag gacctgcgct cctggaccgc cgcggacacc       660
     gcggctcaga tcacccagcg caagttggag gcggcccgtg cggcggagca gctgagagcc       720
     tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg gaaggagacg       780
     ctgcagcgcg caggtaccag gggc                                              804
//


spacer
spacer