Dbfetch

ID   AF480613; SV 1; linear; genomic DNA; STD; HUM; 1664 BP.
XX
AC   AF480613;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35-related new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1664
RX   DOI; 10.1111/j.1399-0039.2005.00421.x.
RX   PUBMED; 15982258.
RA   Alonso-Nieto M., Garcia-Sanchez F., Lillo R., Balas A., Blanco L.,
RA   Aviles-Egea M.J., Zarapuz L., Vicario J.L.;
RT   "Four new HLA class I alleles in Cauacasoids";
RL   Tissue Antigens 66(1):51-53(2005).
XX
RN   [2]
RP   1-1664
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   "Four new HLA class I alleles in Caucasoids";
RL   Unpublished.
XX
RN   [3]
RP   1-1664
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   ;
RL   Submitted (06-FEB-2002) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Menendez-Pelayo 65, Madrid
RL   28009, Spain
XX
DR   MD5; 3e77468e98d2c3b58723a1a144fc6c4c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1664
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1664
FT                   /gene="HLA-B"
FT                   /note="new allele related to HLA-B*35"
FT   mRNA            join(<1..270,516..791,1367..>1642)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..791,1367..>1642)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen locus B"
FT                   /db_xref="GOA:Q8SNC8"
FT                   /db_xref="IMGT/HLA:B*35:41"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC8"
FT                   /protein_id="AAL87224.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSACDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            516..791
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1367..1642
FT                   /gene="HLA-B"
FT                   /number=4
XX
SQ   Sequence 1664 BP; 327 A; 513 C; 529 G; 295 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcgggggacg gggctgaccg cggggccggg gccagggtct cacatcatcc agaggatgta       540
     tggctgcgac ctggggcccg acgggcgcct cctccgcggg catgaccagt ccgcctgcga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcctatag gtcgccgggg       840
     atggcctccc acgagaagag gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg       900
     aatggagaat ggcatgagtt ttcctgagtt tcctctgagg gccccctctt ctctctagga       960
     caattaaggg atgacgtctc tgaggaaatg gaggggaaga cagtccctag aatactgatc      1020
     aggggtcccc tttgacccct gcagcagcct tgggaaccgt gacttttcct ctcaggcctt      1080
     gttctctgcc tcacactcag tgtgtttggg gctctgattc cagcacttct gagtcacttt      1140
     acctccactc agatcaggag cagaagtccc tgttccccgc tcagagactc gaactttcca      1200
     atgaatagga gattatccca ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct      1260
     tccccacacc aggtgtcctg tccattctca ggctggtcac atgggtggtc ctagggtgtc      1320
     ccatgagaga tgcaaagcgc ctgaattttc tgactcttcc catcagaccc cccaaagaca      1380
     cacgtgaccc accaccccgt ctctgaccat gaggccaccc tgaggtgctg ggccctgggc      1440
     ttctaccctg cggagatcac actgacctgg cagcgggatg gcgaggacca aactcaggac      1500
     actgagcttg tggagaccag accagcagga gatagaacct tccagaagtg ggcagctgtg      1560
     gtggtgcctt ctggagaaga gcagagatac acatgccatg tacagcatga ggggctgccg      1620
     aagcccctca ccctgagatg gggtaaggag ggggatgagg ggtc                       1664
//