spacer

EBI Dbfetch

ID   AF480612; SV 1; linear; genomic DNA; STD; HUM; 1671 BP.
XX
AC   AF480612;
XX
DT   14-MAR-2002 (Rel. 71, Created)
DT   28-OCT-2009 (Rel. 102, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*27-related new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1671
RX   DOI; 10.1111/j.1399-0039.2005.00421.x.
RX   PUBMED; 15982258.
RA   Alonso-Nieto M., Garcia-Sanchez F., Lillo R., Balas A., Blanco L.,
RA   Aviles-Egea M.J., Zarapuz L., Vicario J.L.;
RT   "Four new HLA class I alleles in Cauacasoids";
RL   Tissue Antigens 66(1):51-53(2005).
XX
RN   [2]
RP   1-1671
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   "Four new HLA class I alleles in Caucasoids";
RL   Unpublished.
XX
RN   [3]
RP   1-1671
RA   Garcia-Sanchez F., Vicario J.L., Alonso M., Balas A., Lillo R.;
RT   ;
RL   Submitted (06-FEB-2002) to the INSDC.
RL   Histocompatibility, Regional Transfusion Centre, Menendez-Pelayo 65, Madrid
RL   28009, Spain
XX
DR   MD5; b2e14d4ccd900bfab5a8ae8ba2cdae21.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1671
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1671
FT                   /gene="HLA-B"
FT                   /note="new allele related to HLA-B*27"
FT   mRNA            join(<1..270,515..790,1366..>1641)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,515..790,1366..>1641)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen locus B"
FT                   /db_xref="GOA:Q8SNC9"
FT                   /db_xref="IMGT/HLA:B*27:05:05"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SNC9"
FT                   /protein_id="AAL87223.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            515..790
FT                   /gene="HLA-B"
FT                   /number=3
FT   exon            1366..1641
FT                   /gene="HLA-B"
FT                   /number=4
XX
SQ   Sequence 1671 BP; 326 A; 513 C; 536 G; 296 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagaggac ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg cgcgtttacc       420
     cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc       480
     ggggggacgg ggctgaccgc gggggcgggg ccaggttctc acaccctcca gaatatgtat       540
     ggctgcgacg tggggccgga cgggcgcctc ctccgcgggt accaccagga cgcctacgac       600
     ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgccgc ggacacggcg       660
     gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct gagagcctac       720
     ctggagggcg agtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg       780
     cagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctatagg tcgccgggga       840
     tggcctccca cgagaagagg aggaaaatgg gatcagcgct agaatgtcgc cctcccttga       900
     atggagaatg gcatgagttt tcctgagttt cctctgaggg ccccctcttc tctctaggac       960
     aattaaggga tgacgtctct gaggaaatgg aggggaagac agtccctaga atactgatca      1020
     ggggtcccct ttgacccctg cagcagcctt gggaaccgtg acttttcctc tcaggccttg      1080
     ttctctgcct cacactcagt gtgtttgggg ctctgattcc agcacttctg agtcacttta      1140
     cctccactca gatcaggagc agaagtccct gttccccgct cagagactcg aactttccaa      1200
     tgaataggag attatcccag gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt      1260
     ccccacccca ggtgtcctgt ccattctcag gctggtcaca tgggtggtcc tagggtgtcc      1320
     catgagagat gcaaagcgcc tgaattttct gactcttccc atcagacccc ccaaagacac      1380
     acgtgaccca ccaccccatc tctgaccatg aggccaccct gaggtgctgg gccctgggct      1440
     tctaccctgc ggagatcaca ctgacctggc agcgggatgg cgaggaccaa actcaggaca      1500
     ctgagcttgt ggagaccaga ccagcaggag atagaacctt ccagaagtgg gcagctgtgg      1560
     tggtgccttc tggagaagag cagagataca catgccatgt acagcatgag gggctgccga      1620
     agcccctcac cctgagatgg ggtaaggagg gggatgaggg gtcatatctc t               1671
//


spacer
spacer