Dbfetch

ID   AH011526; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011526; AF479818-AF479819;
XX
DT   07-JUL-2011 (Rel. 109, Created)
DT   07-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Wu J., Williams T.M.;
RT   "Novel human HLA-A allele identified in potential bone marrow donors";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Wu J., Williams T.M.;
RT   ;
RL   Submitted (01-FEB-2002) to the INSDC.
RL   Pathology, University of New Mexico, 915 Camino De Salud, Albuquerque, NM
RL   87131, USA
XX
DR   MD5; 6d81ea11519bf379734b861fe1caa7d3.
XX
CC   On or before Jul 6, 2011 this sequence version replaced
CC   gi:19387198, gi:19387199, gi:19387197.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8SP57"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SP57"
FT                   /protein_id="AAL87131.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQWRAYLEGTC
FT                   VEWLRRYLENRKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 163 C; 196 G; 77 T; 100 other;
     gctcccactc catgaggtat ttctacactt ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac catccagatg atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagtggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa ccggaaggag acgctgcagc gcacgg                      646
//