spacer

EBI Dbfetch

ID   AF469118; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF469118;
XX
DT   12-FEB-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0312 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Schwarz K., Zenz C.;
RT   "Homo sapiens HLA-DQB1*0312 Allele, Exon 2";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Schwarz K., Zenz C.;
RT   ;
RL   Submitted (16-JAN-2002) to the INSDC.
RL   Transfusion Medicine, University of Ulm, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; cc926bdf37b5e761b18c9c0735392534.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /protein_id="AAL77085.1"
FT                   /translation="DFVYQFKAMCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPDAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 270 BP; 60 A; 71 C; 93 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aaggccatgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgacgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//


spacer
spacer