Dbfetch

ID   AF463516; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF463516;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1034/j.1399-0039.2002.600116.x.
RX   PUBMED; 12366792.
RA   Fu Y., Chen W., Liu Z., Lin J., Jia Z., Pan D., Xu A.;
RT   "A novel HLA-DQB1 allele, DQB1*05022, isolated from the Jing ethnic group
RT   in South-west China";
RL   Tissue Antigens 60(1):102-103(2002).
XX
RN   [2]
RP   1-270
RA   Fu Y., Chen W., Liu Z., Jia Z., Pan D., Lin J., Xu A.;
RT   ;
RL   Submitted (28-DEC-2001) to the INSDC.
RL   Department of Biochemistry, School of Life Science, Zhongshan University,
RL   135 W. Xingang Rd, Guangzhou, Guangdong 510275, P. R. China
XX
DR   MD5; b00331d517aa8d077ed62bb55d6cd7ae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8WLT6"
FT                   /db_xref="IMGT/HLA:DQB1*05:02:02"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLT6"
FT                   /protein_id="AAL66389.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRGVTRHIYNREEYVRFDSDVGVYRAV
FT                   TPQGRPSAEYWNSQKEVLEGARASVDRVCRHNYEVAYRGILQRR"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 65 C; 105 G; 42 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     ggggtgtgac cagacacatc tataaccgag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgcaggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggaagtcct ggagggggcc cgggcgtcgg tggacagagt gtgcagacac aactacgagg       240
     tggcgtaccg cgggatcctg cagaggagag                                        270
//