spacer

EBI Dbfetch

ID   AF462072; SV 2; linear; genomic DNA; STD; HUM; 379 BP.
XX
AC   AF462072;
XX
DT   29-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-379
RA   Varney M.D.;
RT   ;
RL   Submitted (21-DEC-2001) to the INSDC.
RL   Victorian Transplantation & Immunogentics Service, Australian Red Cross
RL   Blood Service, c/o Royal Melbourne Hospital, Parkville, Vic 3050, Australia
XX
RN   [2]
RC   Sequence update by submitter
RP   1-379
RA   Varney M.D.;
RT   ;
RL   Submitted (28-FEB-2002) to the INSDC.
RL   Victorian Transplantation & Immunogentics Service, Australian Red Cross
RL   Blood Service, c/o Royal Melbourne Hospital, Parkville, Vic 3050, Australia
XX
DR   MD5; 89f885b65fa5843716e0923dee3563e5.
XX
CC   On Feb 28, 2002 this sequence version replaced gi:18378618.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..379
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            10..273
FT                   /gene="HLA-DPB1"
FT                   /number=2
FT   mRNA            <10..>273
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT   CDS             <10..>273
FT                   /codon_start=3
FT                   /gene="HLA-DPB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q8SND2"
FT                   /db_xref="IMGT/HLA:DPB1*02:01:05"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8SND2"
FT                   /protein_id="AAL68647.2"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREEFVRFDSDVGEFRAVTE
FT                   LGRPDEEYWNSQKDILEEERAVPDRMCRHNYELGGPMTLQRR"
XX
SQ   Sequence 379 BP; 78 A; 100 C; 146 G; 55 T; 0 other;
     tccccgcaga gaattacctt ttccagggac ggcaggaatg ctacgcgttt aatgggacac        60
     agcgcttcct ggagagatac atctacaacc gggaagagtt cgtgcgcttc gacagcgacg       120
     tgggggagtt ccgggcggtg acggagctgg ggcggcctga tgaggagtac tggaacagcc       180
     agaaggacat cctggaggag gagcgggcag tgccggacag gatgtgcaga cacaactacg       240
     agctgggcgg gcccatgacc ctgcagcgcc gaggtgagtg agggctttgg gccggcggtc       300
     ccagggcagc cccgcgggcc cgtgcccagg gcgcaggagc agccgggttg gcctaaggga       360
     ccttagtgcc gggcggaaa                                                    379
//


spacer
spacer