spacer

EBI Dbfetch

ID   AF461431; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF461431;
XX
DT   22-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB3) gene, HLA-DRB3*VNGAZ allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hogbin J.-P., Chapman G., Greville W.D.;
RT   "Novel HLA-DRB3 allele revealed by sequencing based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Hogbin J.-P., Chapman G., Greville W.D.;
RT   ;
RL   Submitted (19-DEC-2001) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; efcc08994e340b38e00f0dc0f4bb3cf3.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:17"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAL66370.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDFLEQKRGQVDNYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 59 A; 61 C; 100 G; 50 T; 0 other;
     cacgtttctt ggagctgctt aagtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga gagacacttc cataaccagg aggagtacgc gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgagg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggagcagaag cggggccagg tggacaatta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer