spacer

EBI Dbfetch

ID   AF455114; SV 1; linear; genomic DNA; STD; HUM; 682 BP.
XX
AC   AF455114;
XX
DT   03-JAN-2002 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen DR beta 3 chain (HLA-DRB3) gene,
DE   HLA-DRB3*0216 allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-682
RA   Avergas C.U., Iglehart B.A., Leffell M.S.;
RT   "Identification of a novel DRB3*0216 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-682
RA   Avergas C.U., Iglehart B.A., Leffell M.S.;
RT   ;
RL   Submitted (05-DEC-2001) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St., Baltimore, MD
RL   21205, USA
XX
DR   MD5; 74f02b499078eaa3e75ad5b65eb937e7.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..682
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>682
FT                   /gene="HLA-DRB3"
FT                   /allele="*0216"
FT   mRNA            <413..>682
FT                   /gene="HLA-DRB3"
FT                   /allele="*0216"
FT                   /product="MHC class II antigen DR beta 3 chain"
FT   CDS             <413..>682
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /allele="*0216"
FT                   /product="MHC class II antigen DR beta 3 chain"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:16"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAL57866.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPAAEHWNSQKDLLEQKRGQVDNYCRHNYGVGESFTVQRR"
FT   exon            413..682
FT                   /gene="HLA-DRB3"
FT                   /allele="*0216"
FT                   /number=2
XX
SQ   Sequence 682 BP; 127 A; 168 C; 265 G; 122 T; 0 other;
     ggatgaacgc ggtgggtgct gtttaaggaa ccggtaaaca tgtgggatga gagaaggagc        60
     agagagtgtt tttcgggtgg aggctcccag gaggaggagg ggcgggctgc ggtgctgggc       120
     ggatcctcct ccagctcctg cttggaggtc tccagaacaa gctggaggca gggatggggg       180
     gtcccaaaag cctggggatg agaaggggtt tccccgcata gtcccccagg cccccgttcg       240
     cctcaggaaa acggaggatg agctcctggg ctgctggtgg tgggcgttgc ggggggggcc       300
     ggttaaggtt cccagtgccc gcacccggcc cagggggccc cggatggcgg cgtcgctgtc       360
     agtgtcttct caggaggccg cctgtgtgac cggagcattc gtgtccccac agcacgtttc       420
     ttggagctgc ttaagtctga gtgtcatttc ttcaatggga cggagcgggt gcggttcctg       480
     gagagacact tccataacca ggaggagtac gcgcgcttcg acagcgacgt gggggagtac       540
     cgggcggtga gggagctggg gcggcctgct gcggagcact ggaacagcca gaaggacctc       600
     ctggagcaga agcggggcca ggtggacaat tactgcagac acaactacgg ggttggtgag       660
     agcttcacag tgcagcggcg ag                                                682
//


spacer
spacer