spacer

EBI Dbfetch

ID   AH011268; SV 2; linear; genomic DNA; STD; HUM; 643 BP.
XX
AC   AH011268; AF450316-AF450317;
XX
DT   01-JUL-2011 (Rel. 109, Created)
DT   01-JUL-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB4) gene, HLA-DRB4*MKOST allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-643
RA   Chapman G., Hogbin J.-P., Greville W.D.;
RT   "Novel HLA-DRB4 Allele Identified by Sequencing Based Typing";
RL   Unpublished.
XX
RN   [2]
RP   1-643
RA   Chapman G., Hogbin J.-P., Greville W.D.;
RT   ;
RL   Submitted (21-NOV-2001) to the INSDC.
RL   Molecular Genetics Lab-Tissue Typing Dept, ARCBS, 153 Clarence Street,
RL   Sydney, NSW 2000, Australia
XX
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
XX
CC   On or before Jun 30, 2011 this sequence version replaced
CC   gi:17933357, gi:17933358, gi:17933356.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..643
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>643
FT                   /gene="HLA-DRB4"
FT                   /allele="HLA-DRB4*MKOST"
FT   mRNA            join(<1..270,371..>643)
FT                   /gene="HLA-DRB4"
FT                   /allele="HLA-DRB4*MKOST"
FT                   /product="MHC class II antigen"
FT   CDS             join(<1..270,371..>643)
FT                   /codon_start=3
FT                   /gene="HLA-DRB4"
FT                   /allele="HLA-DRB4*MKOST"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P13762"
FT                   /db_xref="HGNC:HGNC:4952"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13762"
FT                   /protein_id="AAL48256.1"
FT                   /translation="RFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPL
FT                   QHYNLLVCSVNGFYPGSIEVRWFRNSQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSMMSPLT"
FT   exon            1..270
FT                   /gene="HLA-DRB4"
FT                   /allele="HLA-DRB4*MKOST"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..643
FT                   /gene="HLA-DRB4"
FT                   /allele="HLA-DRB4*MKOST"
FT                   /number=3
XX
SQ   Sequence 643 BP; 130 A; 135 C; 173 G; 105 T; 100 other;
     cacgtttctt ggagcaggct aagtgtgagt gtcatttcct caatgggacg gagcgagtgt        60
     ggaacctgat cagatacatc tataaccaag aggagtacgc gcgctacaac agtgacctgg       120
     gggagtacca ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagatac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn tccaacctaa ggtgactgtg tatccttcaa agacccagcc cctgcagcac       420
     tacaacctcc tggtctgctc tgtgaatggt ttctatccag gcagcattga agtcaggtgg       480
     ttccggaaca gccaggaaga gaaggctggg gtggtgtcca caggcctgat ccagaatgga       540
     gactggacct tccagaccct ggtgatgctg gaaacagttc ctcggagtgg agaggtttac       600
     acctgccaag tggagcatcc aagcatgatg agccctctca cgg                         643
//


spacer
spacer