Dbfetch

ID   AF450094; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF450094;
XX
DT   19-DEC-2001 (Rel. 70, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen DRB1 (HLA-DRB1) gene, HLA-DRB1*04053
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Greville W.D., Chapman G., Hogbin J.-P.;
RT   "Novel HLA-DRB1 alleles revealed by sequencing based typing: DRB1*04053 and
RT   DRB1*1143";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Greville W.D., Chapman G., Hogbin J.-P.;
RT   ;
RL   Submitted (21-NOV-2001) to the INSDC.
RL   Molecular Genetics Laboratory, Tissue Typing Services, Australian Red Cross
RL   Blood Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; c7d6832f43967126aa9acd62fde3a482.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen DRB1"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen DRB1"
FT                   /db_xref="GOA:Q8WLU0"
FT                   /db_xref="IMGT/HLA:DRB1*04:05:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLU0"
FT                   /protein_id="AAL47162.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPSAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 270 BP; 60 A; 66 C; 97 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcgacgag                                        270
//