spacer

EBI Dbfetch

ID   AF439511; SV 1; linear; genomic DNA; STD; HUM; 267 BP.
XX
AC   AF439511;
XX
DT   16-NOV-2001 (Rel. 69, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11011 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-267
RA   Curtoni E.S., Garino E., Bertola L., Berrino M., Mazzola G., Dall'Omo A.M.,
RA   Carcassi C.;
RT   "A novel HLA-A*11011 allele identified by sequence-based-typing";
RL   Unpublished.
XX
RN   [2]
RP   1-267
RA   Curtoni E.S., Garino E., Bertola L., Berrino M., Mazzola G., Dall'Omo A.M.,
RA   Carcassi C.;
RT   ;
RL   Submitted (24-OCT-2001) to the INSDC.
RL   Dept. of Genetics, Biology and Biochemistry, University of Turin, via
RL   Santena,19, Turin 10126, Italy
XX
DR   MD5; 734d9f1dbbb525c7ffe12826104e93fb.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..267
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.1-p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11011 variant"
FT   mRNA            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11011 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>267
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11011 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8WMA2"
FT                   /db_xref="IMGT/HLA:A*11:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WMA2"
FT                   /protein_id="AAL32021.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEA"
FT   exon            <1..>267
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11011 variant"
FT                   /number=2
FT   variation       266
FT                   /gene="HLA-A"
FT                   /replace="a"
FT                   /note="compared to the MHC class I antigen HLA-A*11011
FT                   allele"
XX
SQ   Sequence 267 BP; 52 A; 83 C; 95 G; 37 T; 0 other;
     tcccactcca tgaggtattt ctacacctcc gtgtcccggc ccggccgcgg ggagccccgc        60
     ttcatcgccg tgggctacgt ggacgacacg cagttcgtgc ggttcgacag cgacgccgcg       120
     agccagagga tggagccgcg ggcgccgtgg atagagcagg aggggccgga gtattgggac       180
     caggagacac ggaatgtgaa ggcccagtca cagactgacc gagtggacct ggggaccctg       240
     cgcggctact acaaccagag cgaggcc                                           267
//


spacer
spacer