Dbfetch

ID   AF439338; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   AF439338;
XX
DT   26-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*0311 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Hogbin J.-P., Chapman G., Greville W.D., Dunckley H.;
RT   ;
RL   Submitted (23-OCT-2001) to the INSDC.
RL   Molecular Genetics Lab-Tissue Typing Dept, ARCBS, 153 Clarence Street,
RL   Sydney, NSW 2000, Australia
XX
DR   MD5; 3c74b2646b4b1e7871a6b21ef523ab0e.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>270
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   exon            1..270
FT                   /gene="HLA-DQB1"
FT                   /number=2
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*03:11"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAL35222.1"
FT                   /translation="DFVYQFKGLCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAV
FT                   TPLGPPAAEYWNSQKEVLERTRAELDTVCRHNYQLELRTTLQRR"
XX
SQ   Sequence 270 BP; 58 A; 72 C; 94 G; 46 T; 0 other;
     aggatttcgt gtaccagttt aagggcctgt gctacttcac caacgggacg gagcgcgtgc        60
     gtcttgtgac cagatacatc tataaccgag aggagtacgc acgcttcgac agcgacgtgg       120
     gggtgtatcg ggcggtgacg ccgctggggc cgcctgccgc cgagtactgg aacagccaga       180
     aggaagtcct ggagaggacc cgggcggagt tggacacggt gtgcagacac aactaccagt       240
     tggagctccg cacgaccttg cagcggcgag                                        270
//