spacer

EBI Dbfetch

ID   AF436095; SV 1; linear; mRNA; STD; HUM; 593 BP.
XX
AC   AF436095;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*3905 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-593
RX   DOI; 10.1007/s002510050307.
RX   PUBMED; 9321426.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Perez-Blas M.,
RA   Granados J., Layrisse Z., Montoya F., Varela P., Arnaiz-Villena A.;
RT   "Generation of the HLA-B35, -B5, -B16, and B15 groups of alleles studied by
RT   intron 1 and 2 sequence analysis";
RL   Immunogenetics 46(6):469-476(1997).
XX
RN   [2]
RP   1-593
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Perez-Blas M.,
RA   Granados J., Layrisse Z., Montoya F., Varela P., Arnaiz-Villena A.;
RT   ;
RL   Submitted (16-OCT-2001) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia s/n, Madrid 28041, Spain
XX
DR   MD5; e6d22849467e0ad582e3eb93ed71dfd5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..593
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>593
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95HM0"
FT                   /db_xref="IMGT/HLA:B*39:05:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HM0"
FT                   /protein_id="AAL30414.1"
FT                   /translation="LLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDD
FT                   TQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTYRESLRNLRGYYNQSE
FT                   AGSHTLQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWE
FT                   AARVAEQLRTYLEGTCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 593 BP; 117 A; 192 C; 204 G; 80 T; 0 other;
     cctcctgctg ctctcggcgg ccctggccct gaccgagacc tgggccggct cccactccat        60
     gaggtatttc tacacctccg tgtcccggcc cggccgcggg gagccccgct tcatctcagt       120
     gggctacgtg gacgacacgc agttcgtgag gttcgacagc gacgccgcga gtccgagaga       180
     ggagccgcgg gcgccgtgga tagagcagga ggggccggaa tattgggacc ggaacacaca       240
     gatctgcaag accaacacac agacttaccg agagagcctg cggaacctgc gcggctacta       300
     caaccagagc gaggccgggt ctcacaccct ccagaggatg tacggctgcg acgtggggcc       360
     ggacgggcgc ctcctccgcg ggcataacca gttcgcctac gacggcaagg attacatcgc       420
     cctgaacgag gacctgagct cctggaccgc ggcggacacc gcggctcaga tcacccagcg       480
     caagtgggag gcggcccgtg tggcggagca gctgagaacc tacctggagg gcacgtgcgt       540
     ggagtggctc cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cgg              593
//


spacer
spacer