spacer

EBI Dbfetch

ID   AF436090; SV 1; linear; mRNA; STD; HUM; 608 BP.
XX
AC   AF436090;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*15011 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-608
RX   DOI; 10.1007/s002510050307.
RX   PUBMED; 9321426.
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Perez-Blas M.,
RA   Granados J., Layrisse Z., Montoya F., Varela P., Arnaiz-Villena A.;
RT   "Generation of the HLA-B35, -B5, -B16, and B15 groups of alleles studied by
RT   intron 1 and 2 sequence analysis";
RL   Immunogenetics 46(6):469-476(1997).
XX
RN   [2]
RP   1-608
RA   Gomez-Casado E., Vargas-Alarcon G., Martinez-Laso J., Perez-Blas M.,
RA   Granados J., Layrisse Z., Montoya F., Varela P., Arnaiz-Villena A.;
RT   ;
RL   Submitted (16-OCT-2001) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia s/n, Madrid 28041, Spain
XX
DR   MD5; dd9722a9b59184db39dddbe00d335390.
DR   Ensembl-Gn; ENSG00000232126; homo_sapiens.
DR   Ensembl-Tr; ENST00000450871; homo_sapiens.
DR   Ensembl-Tr; ENST00000471639; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..608
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>608
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95HM5"
FT                   /db_xref="IMGT/HLA:B*15:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HM5"
FT                   /protein_id="AAL30409.1"
FT                   /translation="APRTVLLLLSGALALTETWAGSHSMRYFYTAMSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASPRMAPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGY
FT                   YNQSEAGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQIT
FT                   QRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 608 BP; 116 A; 200 C; 213 G; 79 T; 0 other;
     ggcgccccga accgtcctcc tgctgctctc gggagccctg gccctgaccg agacctgggc        60
     cggctcccac tccatgaggt atttctacac cgccatgtcc cggcccggcc gcggggagcc       120
     ccgcttcatc gcagtgggct acgtggacga cacccagttc gtgaggttcg acagcgacgc       180
     cgcgagtccg aggatggcgc cccgggcgcc atggatagag caggaggggc cggagtattg       240
     ggaccgggag acacagatct ccaagaccaa cacacagact taccgagaga gcctgcggaa       300
     cctgcgcggc tactacaacc agagcgaggc cgggtctcac accctccaga ggatgtacgg       360
     ctgcgacgtg gggccggacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg       420
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acacggcggc       480
     tcagatcacc cagcgcaagt gggaggcggc ccgtgaggcg gagcagtgga gagcctacct       540
     ggagggcctg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       600
     gcgcgcgg                                                                608
//


spacer
spacer