Dbfetch

ID   AF436089; SV 1; linear; mRNA; STD; HUM; 546 BP.
XX
AC   AF436089;
XX
DT   14-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) mRNA, HLA-G*01041 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-546
RA   Arnaiz-Villena A.;
RT   "HLA class I polymorphism";
RL   Unpublished.
XX
RN   [2]
RP   1-546
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (16-OCT-2001) to the INSDC.
RL   Immunology and Molecular Biology, Hospital 12 de Octubre, Carretera de
RL   Andalucia s/n, Madrid 28041, Spain
XX
DR   MD5; ef6aa862508dfa24296b5568170ee8df.
DR   H-InvDB; HIT000079647_05.4.
DR   H-InvDB; HIT000079647_06.4.
DR   H-InvDB; HIT000079647_07.4.
DR   H-InvDB; HIT000079647_08.4.
DR   H-InvDB; HIT000079647_09.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             <1..>546
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95HM6"
FT                   /db_xref="H-InvDB:HIT000079647_04.4"
FT                   /db_xref="IMGT/HLA:G*01:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HM6"
FT                   /protein_id="AAL30408.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLIRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRA"
XX
SQ   Sequence 546 BP; 116 A; 163 C; 187 G; 80 T; 0 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcggttcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggcca gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca gttctcacac cctccagtgg atgattggct       300
     gcgacctggg gtccgacgga cgcctcatcc gcgggtatga acagtatgcc tacgatggca       360
     aggattacct cgccctgaac gaggacctgc gctcctggac cgcagcggac actgcggctc       420
     agatctccaa gcgcaagtgt gaggcggcca atgtggctga acaaaggaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccacagat acctggagaa cgggaaggag atgctgcagc       540
     gcgcgg                                                                  546
//