Dbfetch

ID   AF428252; SV 1; linear; mRNA; STD; HUM; 1110 BP.
XX
AC   AF428252;
XX
DT   07-NOV-2002 (Rel. 73, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*3924-C183 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RX   DOI; 10.1046/j.1365-2370.2003.00362.x.
RX   PUBMED; 12558815.
RA   Estefania E., Gomez-Lozano N., De Pablo R., Moreno M.E., Vilches C.;
RT   "Complementary DNA sequence of the HLA-B*3924 allele";
RL   Eur. J. Immunogenet. 30(1):11-12(2003).
XX
RN   [2]
RP   1-1110
RA   Estefania E., Vilches C.;
RT   ;
RL   Submitted (04-OCT-2001) to the INSDC.
RL   Inmunologia, HU Clinica Puerta de Hierro, San Martin de Porres 4, Madrid
RL   28035, Spain
XX
DR   MD5; e30afd9f4271a488f8dc0f57ea515e82.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="female"
FT                   /cell_line="C183"
FT                   /tissue_type="PBMC"
FT                   /db_xref="taxon:9606"
FT   CDS             5..1093
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P30475"
FT                   /db_xref="H-InvDB:HIT000079519_03.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*39:24:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036179"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="PDB:4O2C"
FT                   /db_xref="PDB:4O2E"
FT                   /db_xref="PDB:4O2F"
FT                   /db_xref="UniProtKB/Swiss-Prot:P30475"
FT                   /protein_id="AAN63555.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQICKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSTYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1110 BP; 229 A; 343 C; 364 G; 174 T; 0 other;
     cgagatgctg gtcatggcgc cccgaaccgt cctcctgctg ctctcggcgg ccctggccct        60
     gaccgagacc tgggccggct cccactccat gaggtatttc tacacctccg tgtcccggcc       120
     cggccgcggg gagccccgct tcatctcagt gggctacgtg gacgacacgc agttcgtgag       180
     gttcgacagc gacgccgcga gtccgagaga ggagccgcgg gcgccgtgga tagagcagga       240
     ggggccggaa tattgggacc ggaacacaca gatctgcaag accaacacac agactgaccg       300
     agagagcctg cggaacctgc gcggctacta caaccagagc gaggccgggt ctcacaccct       360
     ccagagcacg tacggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggcataacca       420
     gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc       480
     ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg tggcggagca       540
     gctgagaacc tacctggagg gcacgtgcgt ggagtggctc cgcagatacc tggagaacgg       600
     gaaggagacg ctgcagcgcg cggacccccc aaagacacat gtgacccacc accccatctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc       780
     agcaggagac agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatggga       900
     gccatcttcc cagtccaccg tccccatcgt gggcattgtt gctggcctgg ctgtcctagc       960
     agttgtggtc atcggagctg tggtcgctgc tgtgatgtgt aggaggaaga gttcaggtgg      1020
     aaaaggaggg agctactctc aggctgcgtc cagcgacagt gcccagggct ctgatgtgtc      1080
     tctcacagct tgaaaagcct gagacagctg                                       1110
//