spacer

EBI Dbfetch

ID   AF427138; SV 1; linear; genomic DNA; STD; HUM; 320 BP.
XX
AC   AF427138;
XX
DT   01-NOV-2001 (Rel. 69, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate VTIS45001 MHC class II antigen (HLA-DRB3) gene,
DE   HLA-DRB3-02NEW allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-320
RA   Varney M.;
RT   "A Novel DRB3 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-320
RA   Varney M.;
RT   ;
RL   Submitted (01-OCT-2001) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, Australian Red Cross
RL   Blood Service, c/o Royal Melbourne Hospital, Grattan St., Parkville, Vic
RL   3050, Australia
XX
DR   MD5; a26fa82e372fe849e9c0b49074193e82.
DR   Ensembl-Gn; ENSG00000196101; homo_sapiens.
DR   Ensembl-Gn; ENSG00000230463; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231679; homo_sapiens.
DR   Ensembl-Tr; ENST00000307137; homo_sapiens.
DR   Ensembl-Tr; ENST00000383126; homo_sapiens.
DR   Ensembl-Tr; ENST00000426847; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..320
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /isolate="VTIS45001"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            29..298
FT                   /gene="HLA-DRB3"
FT                   /number=2
FT   mRNA            <29..>298
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT   CDS             <29..>298
FT                   /codon_start=3
FT                   /gene="HLA-DRB3"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P79483"
FT                   /db_xref="HGNC:HGNC:4951"
FT                   /db_xref="IMGT/HLA:DRB3*02:15"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:2Q6W"
FT                   /db_xref="PDB:3C5J"
FT                   /db_xref="PDB:4H1L"
FT                   /db_xref="UniProtKB/Swiss-Prot:P79483"
FT                   /protein_id="AAL26538.1"
FT                   /translation="RFLELLKSECHFFNGTERVRFLERHFHNQEEYARFDSDVGEYRAV
FT                   RELGRPDAEYWNSQKDLLEQKRGQVDTYCRHNYGVGESFTVQRR"
XX
SQ   Sequence 320 BP; 65 A; 76 C; 122 G; 57 T; 0 other;
     tgtgaccgga gcattcgtgt ccccacagca cgtttcttgg agctgcttaa gtctgagtgt        60
     catttcttca atgggacgga gcgggtgcgg ttcctggaga gacacttcca taaccaggag       120
     gagtacgcgc gcttcgacag cgacgtgggg gagtaccggg cggtgaggga gctggggcgg       180
     cctgatgccg agtactggaa cagccagaag gacctcctgg agcagaagcg gggccaggtg       240
     gacacctact gcagacacaa ctacggggtt ggtgagagct tcacagtgca gcggcgaggt       300
     gagcatgtcg gggggcgggg                                                   320
//


spacer
spacer