spacer

EBI Dbfetch

ID   AH011122; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011122; AF417237-AF417238;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*JSILV allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.0001-2815.2004.00207.x.
RX   PUBMED; 15140037.
RA   Hersee J., Dodd R., Greville W.D., Chapman G., Taverniti A., Le T.,
RA   Wallace R., Kennedy A., Dunckley H.;
RT   "Detection of a novel HLA-A allele by polymerase chain
RT   reaction-sequence-specific oligonucleotide typing: HLA-A*0252";
RL   Tissue Antigens 63(6):587-588(2004).
XX
RN   [2]
RP   1-646
RA   Greville W.D., Chapman G., Dodd R., Dunckley H., Hersee J.;
RT   "Novel HLA-A Allele Identified by PCR SSO";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Greville W.D., Chapman G., Dodd R., Dunckley H., Hersee J.;
RT   ;
RL   Submitted (06-SEP-2001) to the INSDC.
RL   Molecular Genetics Lab, Tissue Typing Dept, ARCBS, 153 Clarence Street,
RL   Sydney, NSW 2000, Australia
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:15825446, gi:15825447, gi:15825445.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*JSILV"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*JSILV"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*JSILV"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IB5"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IB5"
FT                   /protein_id="AAL09700.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*JSILV"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*JSILV"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 159 C; 196 G; 79 T; 100 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cgtccagagg atgtatggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtatga acagcacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer