spacer

EBI Dbfetch

ID   AH011062; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH011062; AF411923-AF411925;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I chain-related protein A (MICA) gene, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RX   DOI; 10.1038/sj.gene.6364017.
RX   PUBMED; 14551603.
RA   Tian W., Boggs D.A., Uko G., Essiet A., Inyama M., Banjoko B., Adewole T.,
RA   Ding W.Z., Mohseni M., Fritz R., Chen D.F., Palmer L.J., Fraser P.A.;
RT   "MICA, HLA-B haplotypic variation in five population groups of sub-Saharan
RT   African ancestry";
RL   Genes Immun. 4(7):500-505(2003).
XX
RN   [2]
RP   1-1022
RA   Tian W., Boggs D.A., Ding W.Z., Chen D.F., Fraser P.A.;
RT   "Cloning and sequencing of a new MICA allele found in an African-American
RT   family";
RL   Unpublished.
XX
RN   [3]
RP   1-1022
RA   Tian W., Boggs D.A., Ding W.Z., Chen D.F., Fraser P.A.;
RT   ;
RL   Submitted (22-AUG-2001) to the INSDC.
RL   Center for Blood Research, 800 Huntington Avenue, Boston, MA 02115, USA
XX
DR   MD5; 88967c181507db79a78d81ba10d9520c.
DR   IMGT/LIGM; AH011062.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:15593258, gi:15593259, gi:15593260, gi:15593257.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="MICA"
FT   mRNA            join(<1..255,356..643,744..>1022)
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT   CDS             join(<1..255,356..643,744..>1022)
FT                   /codon_start=3
FT                   /gene="MICA"
FT                   /product="MHC class I chain-related protein A"
FT                   /db_xref="GOA:Q95IC0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IC0"
FT                   /protein_id="AAL02224.1"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRYDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTVPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLESSVVLRRTVPPMVNVTRSEASEGNITVTCRASSFYPRNIILTWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPS"
FT   exon            1..255
FT                   /gene="MICA"
FT                   /number=2
FT   gap             256..355
FT                   /estimated_length=unknown
FT   exon            356..643
FT                   /gene="MICA"
FT                   /number=3
FT   gap             644..743
FT                   /estimated_length=unknown
FT   exon            744..1022
FT                   /gene="MICA"
FT                   /number=4
XX
SQ   Sequence 1022 BP; 215 A; 220 C; 232 G; 155 T; 200 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttcttgc tgaggtacat ctggatggtc agcccttcct gcgctatgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaacggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaagnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnngcttg       360
     cattccctcc aggagattag ggtctgtgag atccatgaag acaacagcac caggagctcc       420
     cagcatttct actacgatgg ggagctcttc ctctcccaaa acctggagac tgaggaatgg       480
     acagtgcccc agtcctccag agctcagacc ttggccatga acgtcaggaa tttcttgaag       540
     gaagatgcca tgaagaccaa gacacactat cacgctatgc atgcagactg cctgcaggaa       600
     ctacggcgat atctagaatc cagcgtagtc ctgaggagaa cagnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnntgccccc catggtgaat gtcacccgca gcgaggcctc       780
     agagggcaac atcaccgtga catgcagggc ttccagcttc tatccccgga atatcatact       840
     gacctggcgt caggatgggg tatctttgag ccacgacacc cagcagtggg gggatgtcct       900
     gcctgatggg aatggaacct accagacctg ggtggccacc aggatttgcc aaggagagga       960
     gcagaggttc acctgctaca tggaacacag cgggaatcac agcactcacc ctgtgccctc      1020
     tg                                                                     1022
//


spacer
spacer