spacer

EBI Dbfetch

ID   AH011058; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011058; AF408164-AF408165;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4033 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2003.00095.x.
RX   PUBMED; 12956882.
RA   Steiner N.K., Gans C., Baldassarre L., Bradshaw D., Rizzo M., Divekar S.,
RA   Koester R., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Twenty-five novel HLA-B alleles";
RL   Tissue Antigens 62(3):263-266(2003).
XX
RN   [2]
RP   1-646
RA   Steiner N.K., Gans C.P., Divekar S., Hurley C.K.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Steiner N.K., Gans C.P., Divekar S., Hurley C.K.;
RT   ;
RL   Submitted (11-AUG-2001) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; ee78e4ba76326bc723700761f8fce7c9.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:15553700, gi:15553701, gi:15553699.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4033 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4033 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4033 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IC3"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IC3"
FT                   /protein_id="AAL01994.1"
FT                   /translation="SHSMRYFHTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4033 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4033 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 112 A; 171 C; 190 G; 73 T; 100 other;
     gctcccactc catgaggtat ttccacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtatga ccagtacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctgc gctcctggac cgccgcggac acggcggctc agatctccca gcgcaagttg       540
     gaggcggccc gtgtggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggac aagctggagc gcgctg                      646
//


spacer
spacer