spacer

EBI Dbfetch

ID   AH011056; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011056; AF408160-AF408161;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*2704 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2003.00095.x.
RX   PUBMED; 12956882.
RA   Steiner N.K., Gans C., Baldassarre L., Bradshaw D., Rizzo M., Divekar S.,
RA   Koester R., Ng J., Hartzman R.J., Hurley C.K.;
RT   "Twenty-five novel HLA-B alleles";
RL   Tissue Antigens 62(3):263-266(2003).
XX
RN   [2]
RP   1-646
RA   Steiner N.K., Hurley C.K., Gans C.P., Divekar S.;
RT   "Novel HLA-B Allele";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Steiner N.K., Hurley C.K., Gans C.P., Divekar S.;
RT   ;
RL   Submitted (11-AUG-2001) to the INSDC.
RL   Oncology, Georgetown University Medical Center, 3970 Reservoir Road, NW,
RL   Washington, DC 20007, USA
XX
DR   MD5; b566965e11aaf975e65c89680a63783f.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:15553692, gi:15553693, gi:15553691.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2704 variant"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2704 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2704 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IB9"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IB9"
FT                   /protein_id="AAL01992.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQICKAKAQTDRESLRTLLRYYNQSEAGSHTLQNMYGCDVGP
FT                   DGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2704 variant"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*2704 variant"
FT                   /number=3
XX
SQ   Sequence 646 BP; 108 A; 172 C; 195 G; 71 T; 100 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aaggccaagg cacagactga ccgagagagc ctgcggaccc       240
     tgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagaat atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggtacca ccaggacgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagtggaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer