spacer

EBI Dbfetch

ID   AF403249; SV 1; linear; genomic DNA; STD; HUM; 791 BP.
XX
AC   AF403249;
XX
DT   05-FEB-2002 (Rel. 70, Created)
DT   16-DEC-2008 (Rel. 98, Last updated, Version 5)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*18 variant allele,
DE   exons 2 and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-791
RA   Fichter K.M., Hauptfeld-Dolesjek V., Baxter-Lowe L.-A.;
RT   "Nucleotide sequencing reveals a novel HLA-B*18 polymorphism encoding a
RT   serine at position 97";
RL   Unpublished.
XX
RN   [2]
RP   1-791
RA   Fichter K.M., Hauptfeld-Dolesjek V., Baxter-Lowe L.-A.;
RT   ;
RL   Submitted (27-JUL-2001) to the INSDC.
RL   Dept. of Surgery, Immunogenetics & Transplantation Lab at UCSF, Main
RL   Hospital Level B, 45 Castro Street, San Francisco, CA 94114, USA
XX
DR   MD5; e2fe21d4f0435d2a952d1dce2921ea77.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..791
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18 variant"
FT   mRNA            join(<1..270,517..>791)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>791)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q8WLU2"
FT                   /db_xref="IMGT/HLA:B*18:14"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q8WLU2"
FT                   /protein_id="AAL73385.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18 variant"
FT                   /number=2
FT   exon            517..791
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18 variant"
FT                   /number=3
XX
SQ   Sequence 791 BP; 140 A; 271 C; 280 G; 100 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagagcatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagacacct ggagaacggg aaggagacgc       780
     tgcagcgcgc g                                                            791
//


spacer
spacer