spacer

EBI Dbfetch

ID   AH011066; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH011066; AF402320-AF402321;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*3808 allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.0001-2815.2004.00205.x.
RX   PUBMED; 15140041.
RA   Dodd R., Hersee J., Greville W.D., Chapman G., Taverniti A., Le T.,
RA   Wallace R., Kennedy A., Dunckley H.;
RT   "New HLA-B alleles detected by polymerase chain reaction-sequence-specific
RT   oligonucleotide typing: HLA-B*0725, B*0728, and B*3808";
RL   Tissue Antigens 63(6):598-599(2004).
XX
RN   [2]
RP   1-646
RA   Chapman G., Dodd R., Greville W.D., Dunckley H.;
RT   "Novel HLA-B Allele Identified by PCR SSO";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Chapman G., Dodd R., Greville W.D., Dunckley H.;
RT   ;
RL   Submitted (25-JUL-2001) to the INSDC.
RL   Molecular Genetics Lab-Tissue Typing Dept, ARCBS, 153 Clarence Street,
RL   Sydney, NSW 2000, Australia
XX
DR   MD5; 30211952d9d7120915b0cf13ec718273.
DR   Ensembl-Gn; ENSG00000223532; homo_sapiens.
DR   Ensembl-Tr; ENST00000425848; homo_sapiens.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:15637332, gi:15637333, gi:15637331.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3808"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3808"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3808"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95365"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q95365"
FT                   /protein_id="AAL04500.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRTALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGMC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3808"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3808"
FT                   /number=3
XX
SQ   Sequence 646 BP; 114 A; 173 C; 186 G; 73 T; 100 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagaac ctgcgcaccg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac cctccagagg atgtacggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagttcgcc tacgacggca aggattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgtggcgga gcagctgaga acctacctgg agggcatgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer