Dbfetch

ID   AF389378; SV 1; linear; mRNA; STD; HUM; 1110 BP.
XX
AC   AF389378;
XX
DT   01-NOV-2001 (Rel. 69, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) mRNA, HLA-B*3704 allele, complete
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1110
RA   Estefania E., Gomez-Lozano N., de Pablo R., Moreno M.E., Vilches C.;
RT   "Complementary DNA sequence of the novel HLA-B*3704 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-1110
RA   Estefania E., Vilches C., Gomez-Lozano N.;
RT   ;
RL   Submitted (07-JUN-2001) to the INSDC.
RL   Servicio de Inmunologia, H.U. Clinica Puerta de Hierro, San Martin de
RL   Porres 4, Madrid 28035, Spain
XX
DR   MD5; 91c8aca7671ccf1348875ce529b01f82.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1110
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="mRNA"
FT                   /sex="male"
FT                   /haplotype="HLA-A1, Cw6, B*3704, DRB1*11, DRB3*02"
FT                   /cell_line="H156-H2"
FT                   /tissue_type="PBMC"
FT                   /db_xref="taxon:9606"
FT   CDS             5..1093
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:P18463"
FT                   /db_xref="H-InvDB:HIT000078812_03.4"
FT                   /db_xref="HGNC:HGNC:4932"
FT                   /db_xref="IMGT/HLA:B*37:04:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/Swiss-Prot:P18463"
FT                   /protein_id="AAL26324.1"
FT                   /translation="MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRETQISKTNTQTYREDLRT
FT                   LLRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGK
FT                   GGSYSQAASSDSAQGSDVSLTA"
XX
SQ   Sequence 1110 BP; 228 A; 343 C; 364 G; 175 T; 0 other;
     cgagatgcgg gtcacggcgc cccgaaccct cctcctgctg ctctgggggg cagtggccct        60
     gaccgagacc tgggctggct cccactccat gaggtatttc cacacctccg tgtcccggcc       120
     cggccgcggg gagccccgct tcatctcagt gggctacgtg gacgacaccc agttcgtgag       180
     gttcgacagc gacgccgcga gtccgaggac ggagccccgg gcgccgtgga tagagcagga       240
     ggggccggag tattgggacc gggagacaca gatctccaag accaacacac agacttaccg       300
     agaggacctg cggaccctgc tccgctacta caaccagagc gaggccgggt ctcacaccat       360
     ccagaggatg tctggctgcg acgtggggcc ggacgggcgc ctcctccgcg ggtataacca       420
     gttcgcctac gacggcaagg attacatcgc cctgaacgag gacctgagct cctggaccgc       480
     ggcggacacc gcggctcaga tcacccagcg caagtgggag gcggcccgtg tggcggagca       540
     ggacagagcc tacctggagg gcacgtgcgt ggagtggctc cgcagacacc tggagaacgg       600
     gaaggagacg ctgcagcgcg cggacccccc aaagacacat gtgacccacc accccatctc       660
     tgaccatgag gccaccctga ggtgctgggc cctgggcttc taccctgcgg agatcacact       720
     gacctggcag cgggatggcg aggaccaaac tcaggacacc gagcttgtgg agaccagacc       780
     agcaggagat agaaccttcc agaagtgggc agctgtggtg gtgccttctg gagaagagca       840
     gagatacaca tgccatgtac agcatgaggg gctgccgaag cccctcaccc tgagatggga       900
     gccatcttcc cagtccacca tccccatcgt gggcattgtt gctggcctgg ctgtcctagc       960
     agttgtggtc atcggagctg tggtcgctac tgtgatgtgt aggaggaaga gctcaggtgg      1020
     aaaaggaggg agctactctc aggctgcgtc cagcgacagt gcccagggct ctgatgtgtc      1080
     tctcacagct tgaaaagcct gagacagctg                                       1110
//