Dbfetch

ID   AF386759; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   AF386759;
XX
DT   25-JUN-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44022 allele, exon 4
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Canossi A., Piancatelli D., Del Beato T., Liberatore G., Di Rocco M.,
RA   Aureli A., Casciani C.U., Adorno D.;
RT   "The description of the HLA-B*44022 allele exon 4";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Canossi A., Piancatelli D., Del Beato T., Liberatore G., Di Rocco M.,
RA   Aureli A., Casciani C.U., Adorno D.;
RT   ;
RL   Submitted (28-MAY-2001) to the INSDC.
RL   Istituto CNR Tipizzazione Tissutale e Problemi della Dialisi, Piazzale
RL   Collemaggio, L'Aquila 67100, Italy
XX
DR   MD5; ce4d080090557adab60203c1e6ffa411.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /isolate="GN00350"
FT                   /mol_type="genomic DNA"
FT                   /country="USA"
FT                   /tissue_type="blood"
FT                   /db_xref="taxon:9606"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /number=4
FT                   /note="similar to HLA-B*44021"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*44:02:02"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HA7"
FT                   /protein_id="AAK66765.1"
FT                   /translation="PPKTHVTHHPISDHEVTLRCWALGFYPAEITLTWQRDGEDQTQDT
FT                   ELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW"
XX
SQ   Sequence 276 BP; 68 A; 83 C; 82 G; 43 T; 0 other;
     accccccaaa gacacatgtg acccaccacc ccatctctga ccatgaggtc accctgaggt        60
     gctgggccct gggcttctac cctgcggaga tcacactgac ctggcagcgg gatggcgagg       120
     accaaactca ggacaccgag cttgtggaga ccagaccagc aggagataga accttccaga       180
     agtgggcagc tgtggtggtg ccttctggag aagagcagag atacacatgc catgtacagc       240
     atgaggggct gccgaagccc ctcaccctga gatggg                                 276
//