spacer

EBI Dbfetch

ID   AF384666; SV 1; linear; genomic DNA; STD; HUM; 2064 BP.
XX
AC   AF384666;
XX
DT   25-JUN-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*36 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2064
RA   Rozemuller E., Bongers R., Voorter C., Osselaar, Tilanus M.G.J.;
RT   "Identification of a new HLA-A*36 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-2064
RA   Tilanus M.G.J., Bongers R., Rozemuller E.;
RT   ;
RL   Submitted (22-MAY-2001) to the INSDC.
RL   Pathology, University Medical Centre, Utrecht, P.O.Box 85500, Utrecht
RL   3508GA, The Netherlands
XX
DR   MD5; f90ac772d2be732395d7f7739bdfd04b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2064
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            join(<1..73,204..473,715..990,1570..1845,1948..>2064)
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,204..473,715..990,1570..1845,1948..>2064)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IG4"
FT                   /db_xref="IMGT/HLA:A*36:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IG4"
FT                   /protein_id="AAK66558.1"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTLQMMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSS"
XX
SQ   Sequence 2064 BP; 381 A; 634 C; 674 G; 375 T; 0 other;
     atggccgtca tggcgccccg aaccctcctc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cgggtgagtg cggggtcggg agggaaaccg cctctgcggg gagaagcaag       120
     gggccctcct ggcgggggcg caggaccggg ggagccgcgc cgggaggagg gtcgggcagg       180
     tctcagccac tgctcgcccc caggctccca ctccatgagg tatttcttca catccgtgtc       240
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       300
     cgtgcggttc gacagcgacg ccgcgagcca gaagatggag ccgcgggcgc cgtggataga       360
     gcaggagggg ccggagtatt gggaccagga gacacggaat atgaaggccc actcacagac       420
     tgaccgagcg aacctgggga ccctgcgcgg ctactacaac cagagcgagg acggtgagtg       480
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc aggtcgccca       540
     cagtctccgg gtccgagatc caccccgaag ccgcgggact ccgagaccct tgtcccggga       600
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       660
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc       720
     acaccctcca gatgatgtat ggctgcgacg tggggccgga cgggcgcttc ctccgcgggt       780
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaacgaggac ctgcgctctt       840
     ggaccgcggc ggacatggca gctcagatca ccaagcgcaa gtgggaggcg gtccatgcgg       900
     cggagcagcg gagagtctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       960
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1020
     cgcctataga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1080
     agaatatcac cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1140
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1200
     ctgaaggagt gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacaccg      1260
     gcagcagcct tgggcccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1320
     gtgtgtgggg gtctgagtcc agcacttctg agtctctcag cctccactca ggtcaggacc      1380
     agaagtcgct gttcccttct cagggaatag aagattatcc caggtgcctg tgtccaggct      1440
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1500
     cacatgcgtg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1560
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1620
     ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1680
     atggggagga ccagacccag gacacggagc tcgtggagac caggcctgca ggggatggaa      1740
     ccttccagaa gtgggcggct gtggtggtgc cttctggaga ggagcagaga tacacctgcc      1800
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      1860
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      1920
     gcccctcacc ttcccctctt ttcccagagc tgtcttccca gcccaccatc cccatcgtgg      1980
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgccg      2040
     tgatgtggag gaggaagagc tcag                                             2064
//


spacer
spacer