Dbfetch

ID   AF384556; SV 1; linear; genomic DNA; STD; HUM; 240 BP.
XX
AC   AF384556;
XX
DT   15-JUN-2002 (Rel. 72, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DQB1) gene, HLA-DQB1*CB846 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-240
RA   Chapman G., Kennedy A., Dunckley H., Greville W.D.;
RT   "Novel HLA-DQB1 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-240
RA   Chapman G., Kennedy A., Dunckley H., Greville W.D.;
RT   ;
RL   Submitted (20-MAY-2001) to the INSDC.
RL   Molecular Genetic Lab, Tissue Typing Services, Australian Red Cross Blood
RL   Service, 153 Clarence Street, Sydney, NSW 2000, Australia
XX
DR   MD5; 06309926d204e6a409a548f9ee307b2c.
DR   Ensembl-Gn; ENSG00000225824; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231286; homo_sapiens.
DR   Ensembl-Gn; ENSG00000233209; homo_sapiens.
DR   Ensembl-Tr; ENST00000399088; homo_sapiens.
DR   Ensembl-Tr; ENST00000413089; homo_sapiens.
DR   Ensembl-Tr; ENST00000416192; homo_sapiens.
DR   Ensembl-Tr; ENST00000419914; homo_sapiens.
DR   Ensembl-Tr; ENST00000422950; homo_sapiens.
DR   Ensembl-Tr; ENST00000424806; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..240
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>240
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>240
FT                   /codon_start=1
FT                   /gene="HLA-DQB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P01920"
FT                   /db_xref="HGNC:HGNC:4944"
FT                   /db_xref="IMGT/HLA:DQB1*06:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:1JK8"
FT                   /db_xref="PDB:1NBN"
FT                   /db_xref="PDB:1S9V"
FT                   /db_xref="PDB:1UVQ"
FT                   /db_xref="PDB:2NNA"
FT                   /db_xref="PDB:4GG6"
FT                   /db_xref="PDB:4OZF"
FT                   /db_xref="PDB:4OZG"
FT                   /db_xref="PDB:4OZH"
FT                   /db_xref="PDB:4OZI"
FT                   /db_xref="UniProtKB/Swiss-Prot:P01920"
FT                   /protein_id="AAM53072.1"
FT                   /translation="FQFKGLCYFTNGTERVRLVTRYIYNREEYARFDSDVGVYRAVTPQ
FT                   GRPDAEYWNSQKEVLEGTRAELDTVCRHNYEVAFR"
FT   exon            <1..>240
FT                   /gene="HLA-DQB1"
FT                   /number=2
XX
SQ   Sequence 240 BP; 50 A; 63 C; 87 G; 40 T; 0 other;
     ttccagttta agggcctgtg ctacttcacc aacgggacgg agcgcgtgcg tcttgtgacc        60
     agatacatct ataaccgaga ggagtacgcg cgcttcgaca gcgacgtggg ggtgtaccgc       120
     gcggtgacgc cgcaggggcg gcctgatgcc gagtactgga acagccagaa ggaagtcctg       180
     gaggggaccc gggcggagtt ggacacggtg tgcagacaca actacgaggt ggcgttccgc       240
//