Dbfetch

ID   AF373015; SV 2; linear; genomic DNA; STD; HUM; 338 BP.
XX
AC   AF373015;
XX
DT   21-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-338
RA   Varney M.D.;
RT   "A Novel DRB1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-338
RA   Varney M.D.;
RT   ;
RL   Submitted (19-APR-2001) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, Australian Red Cross
RL   Blood Service, Grattan Street, Parkville, Vic 3050, Australia
XX
RN   [3]
RC   Sequence update by submitter
RP   1-338
RA   Varney M.D.;
RT   ;
RL   Submitted (19-JUN-2001) to the INSDC.
RL   Victorian Transplantation & Immunogenetics Service, Australian Red Cross
RL   Blood Service, Grattan Street, Parkville, Vic 3050, Australia
XX
DR   MD5; 41701ee1aea2ddab0583bade7d7118b8.
XX
CC   On Jun 26, 2001 this sequence version replaced gi:14134131.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..338
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   exon            20..289
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   mRNA            <20..>289
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <20..>289
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95IG7"
FT                   /db_xref="IMGT/HLA:DRB1*15:12"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IG7"
FT                   /protein_id="AAK54252.2"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEFRAV
FT                   TELGRPSAEYWNSQKDILEQARAAVDTYCRHNYGVVESFTVQRR"
XX
SQ   Sequence 338 BP; 65 A; 85 C; 127 G; 61 T; 0 other;
     atggttcgtg tccccacagc acgtttcctg tggcagccta agagggagtg tcatttcttc        60
     aatgggacgg agcgggtgcg gttcctggac agatacttct ataaccagga ggagtccgtg       120
     cgcttcgaca gcgacgtggg ggagttccgg gcggtgacgg agctggggcg gcctagcgcc       180
     gagtactgga acagccagaa ggacatcctg gagcaggcgc gggccgcggt ggacacctac       240
     tgcagacaca actacggggt tgtggagagc ttcacagtgc agcggcgagg tgagcatggc       300
     cgcgggcggg gcctgagtcc ccgtgagctg gaattatg                               338
//