spacer

EBI Dbfetch

ID   AH010739; SV 2; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   AH010739; AF363789-AF363790;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-B) gene, HLA-B-null allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RC   Erratum:[Tissue Antigens. 2004 Feb;63(2):192]
RP   1-646
RX   DOI; 10.1034/j.1399-0039.2002.600309.x.
RX   PUBMED; 12445310.
RA   Hou J.Y., Luning Prak E., Kearns J., Wu J., Bassinger S., Birkos S.,
RA   Williams T.M., Kamoun M.;
RT   "A nonsense mutation in exon 3 results in the HLA-B null allele B*5127N";
RL   Tissue Antigens 60(3):262-265(2002).
XX
RN   [2]
RP   1-646
RA   Bassinger S., Kamoun M., Williams T.M.;
RT   "Novel Human HLA-B Null Allele Identified in Potential Bone Marrow Donors";
RL   Unpublished.
XX
RN   [3]
RP   1-646
RA   Bassinger S., Kamoun M., Williams T.M.;
RT   ;
RL   Submitted (23-MAR-2001) to the INSDC.
RL   Department of Pathology, University of New Mexico, 915 Camino de Salud NE,
RL   Albuquerque, NM 87131, USA
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:13959105, gi:13959106, gi:13959104.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p23"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-B"
FT                   /allele="null"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-B"
FT                   /allele="null"
FT                   /product="truncated MHC class I antigen"
FT   CDS             join(<1..270,371..531)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="null"
FT                   /product="truncated MHC class I antigen"
FT                   /db_xref="GOA:Q95IZ0"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IZ0"
FT                   /protein_id="AAK51092.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQIT"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="null"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-B"
FT                   /allele="null"
FT                   /number=3
XX
SQ   Sequence 646 BP; 115 A; 171 C; 186 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct gcgacgtggg gccggacggg       420
     cgcctcctcc gcgggcataa ccagtacgcc tacgacggca aagattacat cgccctgaac       480
     gaggacctga gctcctggac cgcggcggac accgcggctc agatcaccta gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagac acctggagaa cgggaaggag acgctgcagc gcgcgg                      646
//


spacer
spacer