Dbfetch

ID   AF363728; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF363728;
XX
DT   09-MAY-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*08022 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Vina M.-F., Burdett L., Li L.;
RT   "Human MHC ClassII DRB1*08022 Variant";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Vina M.-F., Burdett L., Li L.;
RT   ;
RL   Submitted (22-MAR-2001) to the INSDC.
RL   SBT Lab, Bill Young Marrow Donor Program, 5516 Nicholson Lane, Kensington,
RL   MD 20895, USA
XX
DR   MD5; 1b64909423a85c6a53702070e301d6b1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            1..266
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q95HN2"
FT                   /db_xref="IMGT/HLA:DRB1*08:24"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q95HN2"
FT                   /protein_id="AAK51525.1"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQR"
XX
SQ   Sequence 266 BP; 57 A; 61 C; 96 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcgg                                            266
//