spacer

EBI Dbfetch

ID   AH010755; SV 2; linear; genomic DNA; STD; HUM; 1022 BP.
XX
AC   AH010755; AF363678-AF363680;
XX
DT   30-JUN-2011 (Rel. 109, Created)
DT   30-JUN-2011 (Rel. 109, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*24 variant allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1022
RA   Smith A.G., Warnock S., Regen L., McKinney S., Sprague M., Hansen J.;
RT   "Novel HLA alleles detected in a hematopoietic stem cell transplant
RT   population";
RL   Unpublished.
XX
RN   [2]
RP   1-1022
RA   Smith A.G., Warnock S., Regen L., McKinney S., Sprague M., Hansen J.;
RT   ;
RL   Submitted (26-MAR-2001) to the INSDC.
RL   Clinical Immunogenetics, Seattle Cancer Care Alliance, 825 Eastlake East,
RL   Seattle, WA 98109, USA
XX
DR   MD5; ddeb90f5cb5219c28b2c535278ba7e81.
XX
CC   On or before Jun 29, 2011 this sequence version replaced
CC   gi:14029714, gi:14029715, gi:14029716, gi:14029713.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1022
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT   mRNA            join(<1..270,371..646,747..>1022)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,747..>1022)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IZ1"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IZ1"
FT                   /protein_id="AAK52802.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=2
FT                   /note="similar to HLA-A*2403 exon 2"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=3
FT                   /note="similar to HLA-A*2403 exon 3"
FT   gap             647..746
FT                   /estimated_length=unknown
FT   exon            747..1022
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24 variant"
FT                   /number=4
FT                   /note="similar to HLA-A*02 exon 4"
XX
SQ   Sequence 1022 BP; 171 A; 247 C; 282 G; 122 T; 200 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggacggg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcggctc agatcaccaa gcgcaagtgg       540
     gaggcggccc atgtggcgga gcagcagaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacggnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       720
     nnnnnnnnnn nnnnnnnnnn nnnnnnacgc ccccaaaacg catatgactc accacgctgt       780
     ctctgaccat gaagccaccc tgaggtgctg ggccctgagc ttctaccctg cggagatcac       840
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagctcg tggagaccag       900
     gcctgcaggg gatggaacct tccagaagtg ggcggctgtg gtggtgcctt ctggacagga       960
     gcagagatac acctgccatg tgcagcatga gggtttgccc aagcccctca ccctgagatg      1020
     gg                                                                     1022
//


spacer
spacer