spacer

EBI Dbfetch

ID   AF361548; SV 1; linear; mRNA; STD; HUM; 866 BP.
XX
AC   AF361548;
XX
DT   03-APR-2002 (Rel. 71, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB4) mRNA, HLA-DRB4*0103101 allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-866
RX   DOI; 10.1034/j.1399-0039.2002.590108.x.
RX   PUBMED; 11972878.
RA   De Pablo R., Solis R., Balas A., Vilches C.;
RT   "Specific amplification of the HLA-DRB4 gene from c-DNA. Complete coding
RT   sequence of the HLA alleles DRB4*0103101 and DRB4*01033";
RL   Tissue Antigens 59(1):44-46(2002).
XX
RN   [2]
RP   1-866
RA   de Pablo R., Balas A., Solis R., Vilches C.;
RT   ;
RL   Submitted (15-MAR-2001) to the INSDC.
RL   Inmunologia, Clinica Puerta de Hierro, c/ San Martin de Porres 4, Madrid,
RL   Madrid 28035, Spain
XX
DR   MD5; 0631d3b1adb4460c045a7b4ed2826b1b.
DR   Ensembl-Gn; ENSG00000227357; homo_sapiens.
DR   Ensembl-Gn; ENSG00000227826; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231021; homo_sapiens.
DR   Ensembl-Tr; ENST00000411565; homo_sapiens.
DR   Ensembl-Tr; ENST00000411959; homo_sapiens.
DR   Ensembl-Tr; ENST00000457451; homo_sapiens.
DR   H-InvDB; HIT000078389_03.4.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..866
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.31"
FT                   /mol_type="mRNA"
FT                   /cell_line="G081"
FT                   /db_xref="taxon:9606"
FT   CDS             10..810
FT                   /codon_start=1
FT                   /gene="HLA-DRB4"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P13762"
FT                   /db_xref="H-InvDB:HIT000078389_02.4"
FT                   /db_xref="HGNC:HGNC:4952"
FT                   /db_xref="IMGT/HLA:DRB4*01:03:01:01"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:P13762"
FT                   /protein_id="AAM00252.1"
FT                   /translation="MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECH
FT                   FLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEV
FT                   DTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRN
FT                   GQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSE
FT                   SAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS"
XX
SQ   Sequence 866 BP; 201 A; 218 C; 268 G; 179 T; 0 other;
     ttctccagca tggtgtgtct gaagctccct ggaggctcct gtatggcagc gctgacagtg        60
     acattgacgg tgctgagctc cccactggct ttggctgggg acacccaacc acgtttcttg       120
     gagcaggcta agtgtgagtg tcatttcctc aatgggacgg agcgagtgtg gaacctgatc       180
     agatacatct ataaccaaga ggagtacgcg cgctacaaca gtgacctggg ggagtaccag       240
     gcggtgacgg agctggggcg gcctgacgct gagtactgga acagccagaa ggacctcctg       300
     gagcggaggc gggccgaggt ggacacctac tgcagataca actacggggt tgtggagagc       360
     ttcacagtgc agcggcgagt ccaacctaag gtgactgtgt atccttcaaa gacccagccc       420
     ctgcagcacc acaacctcct ggtctgctct gtgaatggtt tctatccagg cagcattgaa       480
     gtcaggtggt tccggaacgg ccaggaagag aaggctgggg tggtgtccac aggcctgatc       540
     cagaatggag actggacctt ccagaccctg gtgatgctgg aaacagttcc tcggagtgga       600
     gaggtttaca cctgccaagt ggagcatcca agcatgatga gccctctcac ggtgcaatgg       660
     agtgcacggt ctgaatctgc acagagcaag atgctgagtg gagtcggggg ctttgtgctg       720
     ggcctgctct tccttgggac agggctgttc atctacttca ggaatcagaa aggacactct       780
     ggacttcagc caacaggact cttgagctga agtgcagatg accacattca aggaagaacc       840
     ttctgcccca gctttgcaag atgaaa                                            866
//


spacer
spacer