Dbfetch

ID   AF359243; SV 1; linear; mRNA; STD; HUM; 687 BP.
XX
AC   AF359243;
XX
DT   12-FEB-2002 (Rel. 70, Created)
DT   07-OCT-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens retinoic acid early transcript 1 (RAET1E) mRNA, RAET1E-F02
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-687
RX   DOI; 10.1006/geno.2001.6673.
RX   PUBMED; 11827464.
RA   Radosavljevic M., Cuillerier B., Wilson M.J., Clement O., Wicker S.,
RA   Gilfillan S., Beck S., Trowsdale J., Bahram S.;
RT   "A cluster of ten novel MHC class I related genes on human chromosome
RT   6q24.2-q25.3";
RL   Genomics 79(1):114-123(2002).
XX
RN   [2]
RP   1-687
RA   Wicker S., Radosavljevic M., Bahram S.;
RT   ;
RL   Submitted (09-MAR-2001) to the INSDC.
RL   Centre de Recherche d'Immunologie et d'Hematologie, Faculte de Medecine, 4
RL   rue Kirschleger, Strasbourg 67085, France
XX
DR   MD5; 144599cccee862b996d7593e972f7892.
DR   Ensembl-Gn; ENSG00000164520; homo_sapiens.
DR   Ensembl-Tr; ENST00000357183; homo_sapiens.
DR   Ensembl-Tr; ENST00000367363; homo_sapiens.
DR   Ensembl-Tr; ENST00000529948; homo_sapiens.
DR   Ensembl-Tr; ENST00000532335; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..687
FT                   /organism="Homo sapiens"
FT                   /mol_type="mRNA"
FT                   /db_xref="taxon:9606"
FT   CDS             22..>687
FT                   /codon_start=1
FT                   /gene="RAET1E"
FT                   /product="retinoic acid early transcript 1"
FT                   /db_xref="GOA:Q8TD07"
FT                   /db_xref="H-InvDB:HIT000078328.12"
FT                   /db_xref="HGNC:HGNC:16793"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8TD07"
FT                   /protein_id="AAL76417.1"
FT                   /translation="MRRISLTSSPVRLLLFLLLLLIALEIMVGGHSLCFNFTIKSLSRP
FT                   GQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVNATSTWGELTQTLGEVGRDLRML
FT                   LCDIKPQIKTSDPSTLQVEMFCQHEAERCTGASWQFTINGEKSLLFDAMNMTWTVINHE
FT                   ASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSS
FT                   "
FT   variation       265
FT                   /gene="RAET1E"
FT                   /note="heterozygous residue"
FT   variation       288
FT                   /gene="RAET1E"
FT                   /note="heterozygous residue"
FT   variation       404
FT                   /gene="RAET1E"
FT                   /note="heterozygous residue"
FT   variation       442
FT                   /gene="RAET1E"
FT                   /note="heterozygous residue"
FT   variation       446
FT                   /gene="RAET1E"
FT                   /note="heterozygous residue"
XX
SQ   Sequence 687 BP; 188 A; 164 C; 165 G; 170 T; 0 other;
     ctgcctgtta ctctccacag tatgcgaaga atatccctga cttctagccc tgtgcgcctt        60
     cttttgtttc tgctgttgct actaatagcc ttggagatca tggttggtgg tcactctctt       120
     tgcttcaact tcactataaa atcattgtcc agacctggac agccctggtg tgaagcgcag       180
     gtcttcttga ataaaaatct tttccttcag tacaacagtg acaacaacat ggtcaaacct       240
     ctgggcctcc tggggaagaa ggtaaatgcc accagcactt ggggagagtt gacccaaacg       300
     ctgggagaag tggggcgaga cctcaggatg ctcctttgtg acatcaaacc ccagataaag       360
     accagtgatc cttccactct gcaagtcgag atgttttgtc aacatgaagc agaacggtgc       420
     actggtgcat cctggcagtt caccatcaat ggagagaaat ccctcctctt tgacgcaatg       480
     aacatgacct ggacagtaat taatcatgaa gccagtaaga tcaaggagac atggaagaaa       540
     gacagagggc tggaaaagta tttcaggaag ctctcaaagg gagactgcga tcactggctc       600
     agggaattct tagggcactg ggaggcaatg ccagaaccga cagtgtcacc agtaaatgct       660
     tcagatatcc actggtcttc ttctagt                                           687
//