Dbfetch

ID   AF352294; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF352294;
XX
DT   30-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, DRB1*03011 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Hurley C., Tang T., Li L., Tu B.;
RT   "Human leukocyte antigen class II HLA-DRB1*03011";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Hurley C., Tang T., Li L., Tu B.;
RT   ;
RL   Submitted (20-FEB-2001) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd, NW,
RL   Washington, DC 20057, USA
XX
DR   MD5; c6dddb4aba7060059f6d7b2f94118c3a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BCP6"
FT                   /db_xref="IMGT/HLA:DRB1*03:20"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCP6"
FT                   /protein_id="AAK27711.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRYLDRYFHNQEENVRFDSDVGEFRAV
FT                   TELGRPDAEYWNSQKDLLEQKRGRVDNYCRHNYGAVESFTVQR"
XX
SQ   Sequence 266 BP; 58 A; 64 C; 96 G; 48 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcatttctt caatgggacg gagcgggtgc        60
     ggtacctgga cagatacttc cataaccagg aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cggggccggg tggacaacta ctgcagacac aactacgggg       240
     ctgtggagag cttcacagtg cagcgg                                            266
//