spacer

EBI Dbfetch

ID   AF352293; SV 1; linear; genomic DNA; STD; HUM; 266 BP.
XX
AC   AF352293;
XX
DT   30-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, DRB1*0403 variant
DE   allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-266
RA   Hurley C., Tang T., Li L., Tu B.;
RT   "Human leukocyte antigen class II HLA-DRB1*0403 variant";
RL   Unpublished.
XX
RN   [2]
RP   1-266
RA   Hurley C., Tang T., Li L., Tu B.;
RT   ;
RL   Submitted (20-FEB-2001) to the INSDC.
RL   Microbiology & Immunology, Georgetown University, 3970 Reservoir Rd, NW,
RL   Washington, DC 20057, USA
XX
DR   MD5; 59bd4d3cc3acdda46dabbe0d9684eff5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..266
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>266
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>266
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BCP7"
FT                   /db_xref="IMGT/HLA:DRB1*04:41"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCP7"
FT                   /protein_id="AAK27710.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEENVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAEVDTYCRHNYGVVESFTVQR"
XX
SQ   Sequence 266 BP; 60 A; 63 C; 96 G; 47 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagaacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcgg                                            266
//


spacer
spacer