Dbfetch

ID   AF349440; SV 1; linear; genomic DNA; STD; HUM; 953 BP.
XX
AC   AF349440;
XX
DT   02-JUL-2001 (Rel. 68, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4426 allele, exons 2
DE   and 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-953
RA   Luo M., Embree J., Ramdahin S., Ndinya-Achola J., Njenga S., Bwayo J.,
RA   Pan S., Mao X., Stuart T., Brunham R., Plummer F.;
RT   "HLA-A and HLA-B alleles in Kenya, Africa: allele frequencies and
RT   identification of novel alleles B*1567 and B*4426";
RL   Tissue Antigens 0:0-0(2001).
XX
RN   [2]
RP   1-953
RA   Luo M., Embree J., Ramdahin S., Ndinya-Achola J., Njenga S., Bwayo J.,
RA   Pan S., Mao X., Stuart T., Brunham R., Plummer F.;
RT   ;
RL   Submitted (14-FEB-2001) to the INSDC.
RL   Medical Microbiology, University of Manitoba, 730 William Avenue, Winnipeg,
RL   Manitoba R3E 0W3, Canada
XX
DR   MD5; 5535df02cbf4d477112ece155a149935.
DR   EuropePMC; PMC150628; 12634388.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..953
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   CDS             join(<101..370,614..>889)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q95IG8"
FT                   /db_xref="IMGT/HLA:B*44:26"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q95IG8"
FT                   /protein_id="AAK69671.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLLVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            101..370
FT                   /gene="HLA-B"
FT                   /number=2
FT   mRNA            join(<101..370,614..>889)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   exon            614..889
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 953 BP; 165 A; 317 C; 351 G; 120 T; 0 other;
     gcccttggga ggagcgaggg gaccgcaggc gggggcgcag gacccgggga gccgcgccgg        60
     gaggagggtc gggcgggtct cagcccctcc tcgcccccag gctcccactc catgaggtat       120
     ttctacaccg ccatgtcccg gcccggccgc ggggagcccc gcttcatcac cgtgggctac       180
     gtggacgaca cgctgttggt gaggttcgac agcgacgcca cgagtccgag gaaggagccg       240
     cgggcgccat ggatagagca ggaggggccg gagtattggg accgggagac acagatctcc       300
     aagaccaaca cacagactta ccgagagaac ctgcgcaccg cgctccgcta ctacaaccag       360
     agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca cgactcccca tcccccacgt       420
     acggcccggg tcgccccgag tctccgggtc cgagatccgc ccccgaggcc gcgggacccg       480
     cccagaccct cgaccggcga gagccccagg cgcgtttacc cggtttcatt ttcagttgag       540
     gccaaaatcc ccgcgggttg gtcggggcgg ggcggggctc gggggacggg gctgaccgcg       600
     gggccggggc cagggtctca catcatccag aggatgtacg gctgcgacgt ggggccggac       660
     gggcgcctcc tccgcgggta tgaccaggac gcctacgacg gcaaggatta catcgccctg       720
     aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg ctcagatcac ccagcgcaag       780
     tgggaggcgg cccgtgtggc ggagcagctg agagcctacc tggagggcct gtgcgtggag       840
     tcgctccgca gatacctgga gaacgggaag gagacgctgc agcgcgcggg taccaggggc       900
     agtggggagc cttccccatc tcctataggt cgccggggat ggcctccaag ggc              953
//