spacer

EBI Dbfetch

ID   AF349316; SV 1; linear; genomic DNA; STD; HUM; 254 BP.
XX
AC   AF349316;
XX
DT   09-APR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0443 allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-254
RA   Tang J., Wilson C.W., Kaslow R.A.;
RT   "A rare DRB1 allele related to DRB1*04011 and *0408";
RL   Unpublished.
XX
RN   [2]
RP   1-254
RA   Tang J., Wilson C.W., Kaslow R.A.;
RT   ;
RL   Submitted (14-FEB-2001) to the INSDC.
RL   Division of Geographic Medicine, University of Alabama at Birmingham, 845
RL   19th Street South, Birmingham, AL 35294, USA
XX
DR   MD5; 99d303c71a45b27860a460f72b3e88f5.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..254
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>254
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   exon            <1..>254
FT                   /gene="HLA-DRB1"
FT                   /number=2
FT   CDS             <1..>254
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q9BCQ0"
FT                   /db_xref="IMGT/HLA:DRB1*04:43"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:Q9BCQ0"
FT                   /protein_id="AAK30584.1"
FT                   /translation="QVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEFRAVTELG
FT                   RPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQR"
XX
SQ   Sequence 254 BP; 56 A; 61 C; 93 G; 44 T; 0 other;
     agcaggttaa acatgagtgt catttcttca acgggacgga gcgggtgcgg ttcctggaca        60
     gatacttcta tcaccaagag gagtacgtgc gcttcgacag cgacgtgggg gagttccggg       120
     cggtgacgga gctggggcgg cctgatgccg agtactggaa cagccagaag gacctcctgg       180
     agcagaggcg ggccgcggtg gacacctact gcagacacaa ctacggggtt ggtgagagct       240
     tcacagtgca gcgg                                                         254
//


spacer
spacer