spacer

EBI Dbfetch

ID   AF346471; SV 1; linear; genomic DNA; STD; HUM; 246 BP.
XX
AC   AF346471;
XX
DT   29-MAR-2001 (Rel. 67, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DPA1) gene, HLA-DPA1-new allele,
DE   partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-246
RA   Grams S.E., Begovich A., Mangaccat J.;
RT   "One new DPA1 Allele";
RL   Unpublished.
XX
RN   [2]
RP   1-246
RA   Grams S.E., Begovich A., Mangaccat J.;
RT   ;
RL   Submitted (07-FEB-2001) to the INSDC.
RL   Human Genetics, Roche Molecular Systems, 1145 Atlantic Ave., Alameda, CA
RL   94501, USA
XX
DR   MD5; 35bcd347d02bdaa6faf0e0985b617f6c.
DR   Ensembl-Gn; ENSG00000168384; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206291; homo_sapiens.
DR   Ensembl-Gn; ENSG00000224103; homo_sapiens.
DR   Ensembl-Gn; ENSG00000228163; homo_sapiens.
DR   Ensembl-Gn; ENSG00000229685; homo_sapiens.
DR   Ensembl-Gn; ENSG00000231389; homo_sapiens.
DR   Ensembl-Gn; ENSG00000235844; homo_sapiens.
DR   Ensembl-Gn; ENSG00000236177; homo_sapiens.
DR   Ensembl-Tr; ENST00000374808; homo_sapiens.
DR   Ensembl-Tr; ENST00000383224; homo_sapiens.
DR   Ensembl-Tr; ENST00000415247; homo_sapiens.
DR   Ensembl-Tr; ENST00000419277; homo_sapiens.
DR   Ensembl-Tr; ENST00000422504; homo_sapiens.
DR   Ensembl-Tr; ENST00000443117; homo_sapiens.
DR   Ensembl-Tr; ENST00000454805; homo_sapiens.
DR   Ensembl-Tr; ENST00000515317; homo_sapiens.
DR   Ensembl-Tr; ENST00000617497; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..246
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   mRNA            <1..>246
FT                   /gene="HLA-DPA1"
FT                   /product="MHC class II antigen"
FT   exon            1..246
FT                   /gene="HLA-DPA1"
FT                   /number=2
FT   CDS             <1..>246
FT                   /codon_start=3
FT                   /gene="HLA-DPA1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:P20036"
FT                   /db_xref="HGNC:HGNC:4938"
FT                   /db_xref="IMGT/HLA:DPA1*01:08"
FT                   /db_xref="InterPro:IPR001003"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="PDB:3LQZ"
FT                   /db_xref="PDB:4P4K"
FT                   /db_xref="PDB:4P4R"
FT                   /db_xref="PDB:4P57"
FT                   /db_xref="PDB:4P5M"
FT                   /db_xref="UniProtKB/Swiss-Prot:P20036"
FT                   /protein_id="AAK27152.1"
FT                   /translation="DHVSTYAAFVQTHRPTGEFMFEFDDDEMFYVDLDKKETVWHLEEF
FT                   GRAFSFEAQGGLANIAILNNNLNTLIQRSNHTQATN"
XX
SQ   Sequence 246 BP; 62 A; 56 C; 65 G; 63 T; 0 other;
     cggaccatgt gtcaacttat gccgcgtttg tacagacgca tagaccaaca ggggagttta        60
     tgtttgaatt tgatgacgat gagatgttct atgtggatct ggacaagaag gagaccgtct       120
     ggcatctgga ggagtttggc cgagcctttt cctttgaggc tcagggcggg ctggctaaca       180
     ttgctatatt gaacaacaac ttgaatacct tgatccagcg ttccaaccac actcaggcca       240
     ccaacg                                                                  246
//


spacer
spacer